KEGG   Rattus norvegicus (rat): 64301
Entry
64301             CDS       T01003                                 

Gene name
Smn1
Definition
(RefSeq) survival motor neuron protein
  KO
K13129  survival motor neuron protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    64301 (Smn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    64301 (Smn1)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    64301 (Smn1)
SSDB
Motif
Pfam: SMN TUDOR DUF1325
Other DBs
NCBI-GeneID: 64301
NCBI-ProteinID: NP_071954
RGD: 620755
Ensembl: ENSRNOG00000018067
Vega: OTTRNOG00000001091
UniProt: O35876
Position
2
AA seq 288 aa
MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDMCETS
DKPKGTARRKPAKKNKNQKKNATAPLKQWKAGDKCSAVWSEDGCVYPATITSVDLKRETC
VVVYTGYGNKEEQNLSDLLSPTCEVANNTEQNTQENESQVSTDDSEHSSRSLRSKAHSKS
KAAPWTSFLPPPPPVPGAGLGPGKPGLRFNGPPPPPPPPPPFLPCWMPPFPSGPPIIPPP
PPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKKEGKKCSHTN
NT seq 867 nt   +upstreamnt  +downstreamnt
atggcgatgggcagcggcggcgcgggctctgagcaggaagacaccgtgctgttccggcgt
ggcaccggccagagtgatgattctgacatttgggatgatacagcattgataaaagcttac
gataaagccgtggcttcctttaagcatgctctaaagaacggtgacatgtgtgaaacttca
gataagccaaaaggcacagctagaagaaaacctgctaagaagaataaaaaccaaaagaag
aatgccacagctccattgaaacagtggaaagctggtgacaaatgctctgccgtttggtcg
gaagatggctgcgtttacccagctaccatcacgtcagttgaccttaagagagaaacctgt
gtcgtggtttatactggatatggaaacaaagaggagcaaaacctatctgatctgctttcc
ccgacctgtgaagtagctaacaatacagaacagaacactcaggagaatgaaagccaagtt
tccacagacgacagtgaacactcctccagatcgctcagaagtaaagcacacagcaagtcc
aaagctgctccatggacctcgtttctccctccacctcccccggtgcccggggcgggatta
ggaccaggaaagccaggtctaaggttcaatggcccaccgccgccgccacctccccctccc
ccgttcttgccgtgttggatgcctccgttcccttcaggaccaccaataattcctccaccc
cctcccatatctcccgactgtctggatgacacggatgctctgggcagtatgctaatctct
tggtacatgagtggttaccacactggttactatatgggtttcagacaaaataaaaaagaa
ggaaagaagtgctcacatacaaattaa

DBGET integrated database retrieval system