KEGG   Rattus norvegicus (rat): 64314Help
Entry
64314             CDS       T01003                                 

Gene name
Casp2
Definition
(RefSeq) caspase 2
  KO
K02186  caspase 2 [EC:3.4.22.55]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    64314 (Casp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    64314 (Casp2)
   01002 Peptidases [BR:rno01002]
    64314 (Casp2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.55  caspase-2
     64314 (Casp2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     64314 (Casp2)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C14: caspase family
   64314 (Casp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD CARD_2
Motif
Other DBs
NCBI-GeneID: 64314
NCBI-ProteinID: NP_071967
RGD: 69274
Ensembl: ENSRNOG00000016707
UniProt: P55215
Position
4q24
AA seq 452 aa AA seqDB search
MAASSGRSQSSLHRKGLMAADRRSRILAVCGMHPDHQETLKKNRVVLAKQLLLSELLEHL
LEKDIITLEMRELIQAKGGSFSQNVELLNLLPKRGPQAFDAFCEALRETRQGHLEDLLLT
TLSDIQHILPPLSCDYDSSLPFSVCESCPPHKQSRLSTDTMEHSLDNGDGPPCLQVKPCT
PEFYQAHYQLAYRLQSQPRGLALVMSNVHFTGEKDLEFRSGGDVDHTTLVTLFKLLGYNV
HVLYDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGGIYGVDGKLLQLQEVFRLF
DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAQSPGCEESDAGKEELMKMRLPT
RSDMICGYACLKGNAAMRNTKRGSWYIEALTQVFSERACDMHVADMLVKVNALIKEREGY
APGTEFHRCKEMSEYCSTLCQQLYLFPGYPPT
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcgagcgggaggtctcagtcttccctgcacaggaaggggctgatggcggct
gacaggaggagcaggattttggcagtgtgtggaatgcatcctgaccatcaggaaactctg
aaaaagaatcgagtggtgctggccaaacagctgctgctgagcgaactgttagaacatctc
ctagaaaaggacattatcactttggaaatgagggagctaatccaggccaaagggggcagt
ttcagccagaatgtggaactcctcaacctgctgccaaagagaggaccccaggcttttgat
gccttctgtgaagccctgcgggagaccaggcagggtcacttggaagacttactgctcaca
accctctctgatatccagcacatactcccaccgttgagctgtgactatgactcaagtctc
cccttctcggtgtgtgagtcctgccctcctcacaagcagtcccgcctatccacagatact
atggaacactccttagataatggtgatggtcctccctgtcttcaggtgaagccatgcact
cctgagttttaccaggcacactaccagctggcctataggttgcagtctcagcctcgtggc
ttggcactggtgatgagtaatgtgcacttcactggagagaaagacctggaatttcgctcc
ggaggggatgtggaccacactactctagtcaccctcttcaagcttttgggctacaatgtc
catgtgctgtatgaccagactgcacaggaaatgcaagagaaacttcagaattttgcacag
ttacctgcacaccgggtcacagactcctgcatagtagcactcctctcacatggtgtggaa
ggtggcatctacggggtggatggcaaactgcttcagctccaagaggtttttcgacttttt
gacaatgctaactgtccaagtctacagaacaaaccaaaaatgttcttcatccaagcatgt
cgtggagatgagacagatagaggggttgaccagcaagatggaaagaaccatgcacaatcc
cctggatgtgaggagagtgatgctggcaaggaggaattaatgaagatgagacttcctact
cgctcagacatgatatgtggctatgcttgccttaaaggcaatgctgccatgcggaatacc
aaacggggttcctggtacattgaggccctcactcaggtgttctctgagagagcttgtgac
atgcacgtggccgacatgcttgttaaggtgaatgcccttatcaaggagcgtgaaggctat
gcccctggtacagaattccaccgatgcaaggagatgtctgagtactgtagtactctgtgc
cagcagctctacctgttcccaggctacccacccacgtga

DBGET integrated database retrieval system