KEGG   Rattus norvegicus (rat): 64317Help
Entry
64317             CDS       T01003                                 

Gene name
Gpx3, GPx-3, GPx-P, GSHPx-3, GSHPx-P, Gpxp
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    64317 (Gpx3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    64317 (Gpx3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    64317 (Gpx3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     64317 (Gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 64317
NCBI-ProteinID: NP_071970
RGD: 69224
Ensembl: ENSRNOG00000052564
UniProt: P23764
Position
10q22
AA seq 226 aa AA seqDB search
MARILRASCLLSLLLAGFVPPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYA
GKYILFVNVASYUGLTDQYLELNALQEELGPFGLVILGFPCNQFGKQEPGENSEILPSLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIR
WNFEKFLVGPDGIPIMRWYHRTTVSNVKMDILSYMRRQAALGARGK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggatccttcgggcatcctgcctcctgtccctgctcctggccgggtttgttccg
ccgggccggggacaagagaagtccaagacagactgccatggcggtatgagcggtaccatc
tacgagtatggagcccttaccatcgatggggaggaatacattccttttaagcagtatgct
ggcaaatacatcctctttgtcaacgtagccagctactgaggtctgacagaccaatacctt
gaactgaatgcactacaagaagaacttggcccattcggcctggtcattctgggcttccct
tgcaaccaatttggcaaacaggagccaggcgagaactcggagatcctgcctagtctcaag
tacgttcgaccgggtgggggctttgtgcctaatttccagctctttgagaaaggagacgtg
aacggggagaaagagcagaagttctacactttcctgaagaactcctgccctcccactgcg
gaactcctgggctcacctggccgcctcttttgggaacccatgaagatccatgacatccgc
tggaactttgagaagttcctggtggggccagatggcataccaattatgcgctggtaccac
cggaccacagtcagcaacgtcaagatggacatcctgtcctatatgaggcggcaggcagcc
ctgggggccagagggaagtaa

DBGET integrated database retrieval system