KEGG   Rattus norvegicus (rat): 64322
Entry
64322             CDS       T01003                                 

Gene name
Dap, Rap7a
Definition
(RefSeq) death-associated protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DAP
Other DBs
NCBI-GeneID: 64322
NCBI-ProteinID: NP_071971
RGD: 620641
Ensembl: ENSRNOG00000010747
UniProt: Q9QX67
Position
2q22
AA seq 102 aa
MSSPPEGKLETKAGHPPAVKVAGIRIVQKHPHTGDGKEKKDKDDQEWESTSPPKPTVYIS
GVIARGDKDFPPAAAQVAHQKPHASMDKHVSPRTQHIQQPRK
NT seq 309 nt   +upstreamnt  +downstreamnt
atgtcttcgcctccagaaggaaagctagagaccaaagctggacatccgcccgccgtgaaa
gtcgctgggattcggattgtgcagaaacacccacacactggagatgggaaggaaaagaaa
gacaaggatgaccaagaatgggaaagcaccagccctcctaaaccaacagtgtacatctct
ggtgttattgcccggggtgacaaagacttccccccagcagctgcacaagtggcccaccag
aagccacatgcctccatggacaaacatgtttctccaagaacgcagcatatccaacagcct
cgcaagtga

DBGET integrated database retrieval system