KEGG   Rattus norvegicus (rat): 64345Help
Entry
64345             CDS       T01003                                 

Gene name
Hif3a, Ipas, Mop7
Definition
(RefSeq) hypoxia inducible factor 3, alpha subunit
  KO
K09096  hypoxia-inducible factor 3 alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    64345 (Hif3a)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    64345 (Hif3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS_11 PAS HIF-1 PAS_4 PAS_9 HLH CbiJ
Motif
Other DBs
NCBI-GeneID: 64345
NCBI-ProteinID: NP_071973
RGD: 70332
Ensembl: ENSRNOG00000017198
UniProt: Q9JHS2
Position
1q21
AA seq 662 aa AA seqDB search
MDWDQDRSSTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTIS
YLRMHRLCAAGEWNQVRKEGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQL
ELIGHSIFDFIHPCDQEELQDALTPRPSLSKKKSEAATGRHFSLRMKSTLTSRGRALNLK
AATWKVLHCSGHMRAYKPPAQTSPAGSPRSEPPLQCLVLICEAIPHPASLEPPLGRGAFL
SRHSLDMKFTYCDERIAEVAGYSPDDLIGCSAYEYIHALDSDAVSRSIHTLLSKGQAVTG
QYRFLARTGGYLWTQTQATVVSGGRGPQSESIICVHFLISRVEENGVVLSLEQTEQHTRR
PPQLGTSSKKGIPGNSLDPPAPRILAFLHPPALSEASLAADPRRFCSPDLRRLMAPILDG
PPTAATPSTPQAARRPQSPLPADLPDQLAVGLENAHRLSTARKNKTMETDLDIAQDPDTP
DLEMLAPYISMDDDFQLNSSEQLPKVHRRPPRTARRPRARSFHGLSPPIPEATLLPRWGS
DPRLNCSSPSKGDPPTAPLTPRTRKRALAQSSEDKGLELLETKPPKRSPRLEPGSVLLPP
LSLSFLLQGRQLPGNQPDPRAPLVDSHEPLGLAPSLLSLYQHEETIQSRNHFLPAAGLAQ
TH
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggactgggaccaagacaggtcgagcaccgagctgcggaaggagaagtcgcgggatgcg
gcccgcagcaggcgcagccaggagacggaggtgctgtaccaactggcgcacaccctgccc
tttgcgcgcggcgtcagcgcgcacctggacaaggcctccatcatgcgcctcacaatcagc
tacttgcgcatgcaccgcctctgcgctgcaggggagtggaaccaggtgagaaaagaggga
gaaccactggacgcctgctacctgaaggccctggagggtttcgtcatggtgctcaccgct
gagggagacatggcttacctgtcggaaaatgtcagcaagcacctgggcctcagtcagctg
gagctcattggacacagtatctttgattttatccatccctgtgaccaagaggaactccag
gatgccctgaccccgagaccaagcctgtcaaagaagaagtcagaagcagcaacaggacgc
cacttttccctgcgaatgaagagcacactcaccagcagggggcgcgcgctgaacctcaaa
gcggccacctggaaggtgctgcactgctcaggacatatgagggcctacaagccccctgca
cagacttcccccgccgggagccctcgctccgagcctcccctgcaatgcctggtgcttatc
tgtgaagccatcccccacccagccagtctggagcccccactgggccgaggggcctttctc
agtcgccacagcctggacatgaagttcacatactgcgacgagaggattgcagaagttgct
ggctacagccccgatgacctgattggctgttctgcctatgaatacatccacgctttggac
tctgatgcagtcagcaggagcatccacactttgctgagcaagggccaggcagtaacaggg
cagtatcgcttcctggcccggactggaggctatctgtggactcagactcaggctacagtg
gtgtcaggggggcggggcccccagtcggaaagtatcatctgcgtccacttcctgatcagc
cgtgtagaagagaacggagtggtgctgtccctggaacaaacggagcaacatactcgcaga
ccccctcagctgggtacctcctcgaagaagggtatcccaggcaacagtctagaccctccc
gctccacggatcctggccttcctgcaccctccagccctgagtgaggcctccctggctgct
gaccctcgccgtttttgtagcccagacctgcgccgcctcatggcacccatcctggatgga
cctcccacagccgctacccccagcaccccgcaagctgccaggagaccccaaagtcctctt
ccggctgatctcccagatcagttggctgtgggcttggagaatgcacacagactctccact
gcccggaaaaacaagaccatggagacagatctagatatagctcaggaccctgacactccg
gacttggagatgttggctccgtacatctccatggatgatgacttccagctcaactccagc
gagcaattgcccaaagtccaccgcagacctcccaggacggcccgcaggcctcgtgctcgg
agcttccatggcctgtcgcctcccatccctgaggccaccctgctgccccgctgggggagt
gatccacgactgaactgttccagcccctccaagggggatccccccacagcccccctgacg
cctagaactcggaagagggccttggcccagagctcagaggacaaagggttggagctgctg
gaaacgaagccccccaagcggtccccaagactagaacctggaagtgtcctgctgcctccg
ctcagcctgagtttccttctgcaaggtcgacaacttccagggaaccagccggatcccaga
gccccactcgtggattcgcatgagcccttgggcctagctccctcgctgctctctctctac
cagcatgaggaaactatccagtccaggaaccacttcctcccagcagcaggcttggcccag
acacactga

DBGET integrated database retrieval system