KEGG   Rattus norvegicus (rat): 64353
Entry
64353             CDS       T01003                                 

Gene name
Pdlim5
Definition
(RefSeq) PDZ and LIM domain protein 5
  KO
K19867  PDZ and LIM domain protein 5/6/7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    64353 (Pdlim5)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 LIM domain-containing proteins
  PDZ-LIM family proteins
   64353 (Pdlim5)
SSDB
Motif
Pfam: LIM PDZ DUF4749 PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 64353
NCBI-ProteinID: NP_445778
RGD: 621076
Ensembl: ENSRNOG00000016419
UniProt: Q62920
Position
2
AA seq 591 aa
MSNYNVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQG
MTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKGEPKEVVKPVPITSPAVSKVTST
TNMAYNKVPRPFGSVSSPKVTSIPSPSSAFTPAHAATSSHASPPPVAAVTPPPLSASGLH
ASANPSAAQCSSPPNTGKPAVHVPRQPTVTSVCSESAQELAEGQRRGSQGDIKQQNGPPR
KHIVERNTEFYHIPTHSDASKKRLIEDTEDWRPRTGTTQSRSFRILAQITGTEHLKESEN
DNAKKANSTPEPSQQSASPLSAAESLESPGSNRPVVAGLRSAAAFKPVGSTSVKSPSWQR
PNQAAPSTGRISNSASSSGTGAPMKPAVGPPQPSDQDTLVQRAEHIPAGKRTPMCAHCNQ
AIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRK
ILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICRGCEFPI
EAGDMFLEALGSTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgagcaactacaatgtgtcattggttggcccagctccttggggtttccggctccaaggt
ggcaaggatttcaacatgcctctgacaatctctagtctgaaagatggtggcaaggcatca
caggcacacgtcagaataggcgatgtggttctcagcattgatggaatcagtgcccaggga
atgactcatctcgaagcgcagaacaagattaaggcttgtacaggctccttgaatatgact
ctgcaaagagcttctgctgctgccaagtctgagccagttgctgtccagaagggggaacct
aaggaagtagttaagcctgtgcccattacatctcctgctgtatccaaagtcacttccaca
accaacatggcttacaataaagtgccacggccctttggctctgtgtcttcaccaaaagtc
acatccatcccatcgccatcgtccgccttcaccccagcccatgccgccacgtcatcacac
gcttcccctccacctgtggctgctgtcactccccctccactctctgcatccggactgcat
gctagtgccaatcctagtgctgcccagtgttcgtctccaccaaacactggtaaacctgca
gttcatgtcccacggcagcccacagtcaccagcgtgtgttccgagtctgctcaggagcta
gcagagggacagagaagaggatcccagggtgacattaaacagcaaaatggcccaccaaga
aaacacatcgtggagcgcaacacggagttttatcacatacccactcacagtgatgccagc
aagaaaaggctgattgaggacactgaggactggcgcccacggactggaacgacacagtct
cgttccttccgaatcctcgcccagatcactgggactgagcatttgaaagaatctgagaat
gacaatgcgaagaaggcaaatagcactccggagccttctcagcagtcagcttcacctctg
agcgcggcggagagcctggagagcccaggttcaaacaggccagtggtggctggcctcagg
tccgctgctgctttcaagcctgtaggatccaccagtgtcaagtcaccaagctggcagcgt
ccaaaccaagcagcaccttctactgggagaatttcaaacagtgcaagctcttcaggtaca
ggggcacccatgaagccagctgtggggccaccccagccaagtgaccaagacactcttgtg
cagagagctgagcacattccggcgggcaagcggactcccatgtgtgcccactgcaaccag
gccatcaggggaccttttctcgtggctctggggaagtcctggcatccagaagaattcaac
tgtgctcactgcaaaaacacgatggcctatataggctttgtggaggagaagggagcactg
tattgtgagctatgttatgagaagttctttgctcctgaatgtggccggtgccagaggaag
atccttggggaagtcatcaatgctttgaagcagacctggcacgtgtcctgttttgtgtgt
gtggcctgtggaaaacccatccgtaataatgttttccacttggaagatggcgagccctac
tgtgagacagactattatgcactttttggaacaatatgtcgcgggtgtgaattccccata
gaggctggtgacatgttcctggaagctctgggctccacctggcatgacacttgctttgtg
tgctccgtgtgttgtgaaagtttggaagggcagacatttttctccaagaaggacaagcca
ctttgcaaaaaacatgctcattctgtgaatttctga

DBGET integrated database retrieval system