KEGG   Rattus norvegicus (rat): 64371
Entry
64371             CDS       T01003                                 

Gene name
Prdx3, Prx3
Definition
(RefSeq) peroxiredoxin 3
  KO
K20011  peroxiredoxin 3 [EC:1.11.1.24 1.11.1.25]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64371 (Prdx3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     64371 (Prdx3)
    1.11.1.25  glutaredoxin-dependent peroxiredoxin
     64371 (Prdx3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   64371 (Prdx3)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC Thioredoxin_8
Other DBs
NCBI-GeneID: 64371
NCBI-ProteinID: NP_071985
RGD: 620040
Ensembl: ENSRNOG00000010958
UniProt: Q9Z0V6
Position
1q55
AA seq 257 aa
MAAAAGRLLWSSVARPASTIFRSISASTVLRPVASRRTCLTDMLWSACPQAKFAFSTSSS
FHTPAVTQHAPHFKGTAVVNGEFKELSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKA
NEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNITLLSDLTKQISRDYGVLLESA
GIALRGLFIIDPNGVIKHLSVNDLPVGRSVEEPLRLVKAFQFVETHGEVCPPNWTPESPT
IKPSPTASKEYFEKVHQ
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcggcagctgcgggaaggttgctctggtcctcggtggctcggcctgcgagcactatt
ttccggagtatttctgcctcaacagttcttaggcctgttgcttctagaagaacctgcttg
acagacatgctgtggtctgcctgtccccaagcaaagtttgcctttagcaccagttcttca
ttccacacccctgctgtcacccagcatgcgccccattttaaaggtactgctgttgtcaat
ggagagttcaaagagctgagtctcgacgactttaaggggaaatacttggtgcttttcttc
taccctttggatttcacatttgtgtgtcctacagaaattgttgctttcagtgacaaagcc
aatgagtttcatgacgtaaactgtgaagtagttgcggtttctgtggattcccacttcagt
catcttgcctggatcaacacgccaagaaagaatggtggtttgggccacatgaacatcacg
ctgttgtcggacttaactaagcagatatcccgagactacggagtactgttggaaagtgct
ggcattgcgctcagaggtctcttcattattgaccctaatggtgtcatcaagcacctgagt
gtcaatgaccttccggtgggccgaagtgtggaagaaccactccgtttggtaaaggcgttc
cagtttgtggagacccatggagaagtctgcccacccaactggacaccagagtcccctacg
atcaagccaagtccaacagcttcaaaagagtactttgagaaggtccatcaataa

DBGET integrated database retrieval system