KEGG   Rattus norvegicus (rat): 64372Help
Entry
64372             CDS       T01003                                 

Gene name
Timm8b, Ddp2
Definition
(RefSeq) translocase of inner mitochondrial membrane 8 homolog B
  KO
K17780  mitochondrial import inner membrane translocase subunit TIM8
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    64372 (Timm8b)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    64372 (Timm8b)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inter membrane space
   TIM8/13 complex
    64372 (Timm8b)
Transporters [BR:rno02000]
 Other transporters
  Primary active transporters [TC:3]
   64372 (Timm8b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-Tim10_DDP DUF842
Motif
Other DBs
NCBI-GeneID: 64372
NCBI-ProteinID: NP_071986
RGD: 619840
Ensembl: ENSRNOG00000009888
UniProt: P62078
Position
8q23
AA seq 83 aa AA seqDB search
MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGSRLDSRTENCLSSCV
DRFIDTTLAITGRFAQIVQKGGQ
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcttggtgaagcggacgaagcggagttacaacgcctggtggccgccgaacag
cagaaggcacagttcactgcgcaggtgcatcacttcatggaactatgttgggataagtgt
gtggagaagccaggaagtcggctagactcccgaactgaaaactgcctctctagctgtgtg
gatcgattcattgacactactcttgccatcaccggtcgttttgcccagatcgtacagaaa
ggagggcagtag

DBGET integrated database retrieval system