KEGG   Rattus norvegicus (rat): 64389Help
Entry
64389             CDS       T01003                                 

Gene name
Defb4, Defb2, Defb3
Definition
(RefSeq) defensin beta 4
  KO
K21100  beta-defensin 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    64389 (Defb4)
   04657 IL-17 signaling pathway
    64389 (Defb4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    64389 (Defb4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    64389 (Defb4)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   64389 (Defb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_beta Innexin
Motif
Other DBs
NCBI-GeneID: 64389
NCBI-ProteinID: NP_071989
RGD: 619944
Ensembl: ENSRNOG00000013939
UniProt: O88514
Position
16q12.5
AA seq 63 aa AA seqDB search
MRIHYLLFSFLLVLLSPLSAFTQSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCC
KKK
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgaggatccattacctcctcttctcatttctcctggtgctgctgtcgcctctttcagcc
tttactcaaagtatcaacaatccaatcacatgcctgaccaaaggaggcgtatgctggggt
ccatgcactggcggttttcgacagattggcacttgtggactgcctagagtgagatgctgc
aagaaaaagtag

DBGET integrated database retrieval system