KEGG   Rattus norvegicus (rat): 64440
Entry
64440             CDS       T01003                                 

Gene name
Syt4
Definition
(RefSeq) synaptotagmin 4
  KO
K19904  synaptotagmin-4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64440 (Syt4)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    64440 (Syt4)
SSDB
Motif
Pfam: C2
Other DBs
NCBI-GeneID: 64440
NCBI-ProteinID: NP_113881
RGD: 68397
Ensembl: ENSRNOG00000017333
UniProt: P50232
Structure
PDB: 
1W15 1W16

Position
18p12
AA seq 425 aa
MAPITTSRVEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRRSAKSNKTPPYKFVHVLKGV
DIYPENLSSKKKFGGDDKSEAKRKAALPNLSLHLDLEKRDLNGNFPKTNPKAGSSSDLEN
VTPKLFPETEKEAVSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGL
PAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPVFDETFTFYGVPYPHIQELSLHF
TVLSFDRFSRDDVIGEVLVPLSGIELSDGKMLMTREIIKRNAKKSSGRGELLVSLCYQST
TNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVF
DIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWH
MLCDG
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggctcctatcaccaccagccgcgtggaattcgatgaaattcccacagtggtgggcatc
ttcagtgcttttggcctggtcttcactgtgtctctctttgcctggatctgctgccagaga
agatccgctaagtccaacaagactcctccatacaagtttgtgcacgtgcttaaaggagtt
gatatctacccagaaaacctaagtagcaaaaagaagtttggaggagatgacaagagtgaa
gcaaagcgtaaagcagctttgcctaacctttccctgcaccttgatctcgagaaacgagac
ctcaatggcaatttccccaaaaccaaccccaaagctggcagctcttctgatctggaaaat
gtcaccccaaagctctttccggagacggaaaaggaggccgtctcccctgagagcttgaag
tccagcacttccctcacttcagaggagaaacaagagaagctgggcactctcttcttgtct
ctagagtacaacttcgagaagaaagcatttgtggtgaacatcaaggaagcccagggctta
ccagccatggatgaacaatccatgacctctgacccatacatcaagatgacaatcttacca
gagaagaagcacaaagtgaaaaccagagtgctgaggaagacgctggaccccgtgtttgac
gaaaccttcacattctatggggtcccttatccccacatccaagagctgtccctgcacttc
accgtcctgagttttgacaggttctcaagagatgatgtcattggagaagtcctcgttcct
ctttcagggattgaattgtcagacgggaaaatgttaatgaccagagagatcatcaagaga
aatgctaagaagtcttctggacggggtgaacttctggtctccctctgttatcagtccact
acaaacacgctcactgtggttgtcttaaaagcgcggcacctaccgaaatctgatgtgtct
ggactttcagatccctacgtcaaagtgaacctgtaccatgccaagaagagaatctctaaa
aagaagactcatgtgaaaaagtgcactcccaacgcagtgttcaacgaactgtttgtcttt
gatattccttgtgagagtcttgaagaaataagtgttgaatttttagttttggattctgaa
aggggatcccgaaatgaggtgatcgggcggttggtcctgggtgccacagcagaaggaagt
ggtggggggcactggaaggagatctgtgacttccccaggagacaaattgctaagtggcat
atgctctgtgatggttag

DBGET integrated database retrieval system