KEGG   Rattus norvegicus (rat): 64445Help
Entry
64445             CDS       T01003                                 

Gene name
St3gal3, Siat6
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00513  Various types of N-glycan biosynthesis
rno00514  Other types of O-glycan biosynthesis
rno00515  Mannose type O-glycan biosynthesis
rno00533  Glycosaminoglycan biosynthesis - keratan sulfate
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    64445 (St3gal3)
   00515 Mannose type O-glycan biosynthesis
    64445 (St3gal3)
   00514 Other types of O-glycan biosynthesis
    64445 (St3gal3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    64445 (St3gal3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    64445 (St3gal3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    64445 (St3gal3)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     64445 (St3gal3)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   64445 (St3gal3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 64445
NCBI-ProteinID: NP_113885
RGD: 68414
Ensembl: ENSRNOG00000019843
UniProt: Q02734
Position
5q36
AA seq 374 aa AA seqDB search
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLILSLDSAGQTLGTEYDRLG
FLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIR
EFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDY
DIVIRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKY
IVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPT
LGSVAVTMALDGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRK
LVKARVITDLSSGI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggactcttggtatttgtacgcaacctgctgctagccctctgcctctttctggtcctg
ggatttttgtattattctgcctggaagctacacttactccaatgggaagactccaattca
ctgattctttcccttgactccgctggacaaaccctaggcacagagtatgataggctgggt
ttcctcctgaagctggactctaaactgcctgcagagctggccaccaagtacgctaacttt
tccgagggagcctgcaaacccggctacgcttcagccatgatgactgccatcttccccagg
ttctccaagccagcacccatgttcctggatgactcctttcgcaaatgggctaggattcgg
gagtttgtgccaccctttgggatcaaaggtcaagacaatctgatcaaagccatcttgtca
gtcaccaaagaataccgcctgacccctgccttggacagcctccactgccgccgctgcatc
atcgtaggcaatggaggggtcctcgccaacaagtctctggggtcacgaattgacgactat
gacattgtgatcagattgaactcagcacctgtgaagggctttgagaaggacgtgggcagc
aagaccaccctgcgcatcacctaccctgaaggtgccatgcagcggcctgagcaatatgaa
cgagactctctctttgtactagctggcttcaagtggcaggacttcaagtggctgaagtac
atcgtctacaaggagagagtgagcgcatccgatggcttctggaagtccgtggccacccga
gtgcccaaggagccccctgagatccgcatcctcaacccgtacttcatccaggaggctgcc
ttcacgctcatcggactgcccttcaacaatggcctcatgggcagagggaacatcccaacc
cttggcagtgtggcagtgaccatggcactcgatggctgtgatgaagtggcagtcgcgggc
tttggctatgacatgaacacacccaacgcccccctgcactactatgaaactgtgcgcatg
gcagccatcaaagagtcctggacacacaacatccagcgagagaaagagtttctgcggaag
ctagtgaaagcacgcgtcatcactgacttaagcagtggtatctga

DBGET integrated database retrieval system