KEGG   Rattus norvegicus (rat): 64461Help
Entry
64461             CDS       T01003                                 

Gene name
Decr2, Dcrakl, putativeperoxisomal24-dienoyl-CoAreductase
Definition
(RefSeq) 2,4-dienoyl-CoA reductase 2
  KO
K13237  peroxisomal 2,4-dienoyl-CoA reductase [EC:1.3.1.34]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    64461 (Decr2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.34  2,4-dienoyl-CoA reductase (NADPH)
     64461 (Decr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-GeneID: 64461
NCBI-ProteinID: NP_741993
RGD: 71002
Ensembl: ENSRNOG00000050424
UniProt: Q9Z2M4
Position
10q12
AA seq 292 aa AA seqDB search
MTQQPPDVEEDDCLSEYHHLFCPDLLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSR
SLPRVSEAAKKLVAATGKRCLPLSMDVRVPPAVMAAVDQALKEFGKIDILINCAAGNFLC
PASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDHGGVIVNITATLSMRGQVLQLHAGA
AKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLGGPKASSKFKYLSSPIPRLG
TKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTLPNDIGRLLEFESSSAKL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcagccgcctgacgttgaggaggatgactgtctttctgaataccaccacctc
ttctgcccggaccttctccaggacaaagtggcttttatcactggtggtggttctgggatt
ggcttccggatcgccgagattttcatgaggcatggctgccacactgtcatcgtcagcagg
agtctgccgagagtgtccgaggctgctaagaagttggttgctgccactggaaagcggtgt
ctccctctgtctatggatgtccgagttcccccagctgtcatggctgctgtggaccaagcg
ctgaaagaatttggcaaaatcgacatcctcattaactgtgctgcagggaactttttatgc
cctgccagtgcattgtctttcaatgcctttaagactgtggtggacattgacacccttggc
accttcaatgtgtctcgtgtgctttatgagaagttcttccgggaccatggaggagtgatc
gtgaacattaccgccaccctcagtatgcgggggcaggtgctgcagctccatgcaggcgct
gccaaggcggctgtggatgctatgacgcgacacttggctgtggagtggggtccccagaat
atccgtgtcaacagcctggctcctggtgccatcagcggcactgagggtctgcggagatta
ggaggccccaaggccagttcgaaatttaagtatctttcaagtcctattccaagactcgga
accaagacagaaatcgcccacagcgtgctgtacctagccagccctctggcttcctatgtc
tcagggattgtgttggtggttgatggtggtagctggatgacgctcccaaatgacattggg
cgactgctagagtttgaatcctcctctgctaagctgtag

DBGET integrated database retrieval system