KEGG   Rattus norvegicus (rat): 64462Help
Entry
64462             CDS       T01003                                 

Gene name
Csnk1d
Definition
(RefSeq) casein kinase 1, delta
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno04390  Hippo signaling pathway
rno04540  Gap junction
rno04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    64462 (Csnk1d)
   04390 Hippo signaling pathway
    64462 (Csnk1d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    64462 (Csnk1d)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    64462 (Csnk1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    64462 (Csnk1d)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    64462 (Csnk1d)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     64462 (Csnk1d)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   64462 (Csnk1d)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    64462 (Csnk1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Motif
Other DBs
NCBI-GeneID: 64462
NCBI-ProteinID: NP_620691
RGD: 71031
Ensembl: ENSRNOG00000036676
UniProt: Q06486
Structure
PDB: 

Position
10q32.3
AA seq 415 aa AA seqDB search
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggagctgagggtcgggaacaggtaccgactgggccgcaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcaggagaagaagttgccatcaagcttgaa
tgtgtcaaaaccaaacatcctcagctccacattgagagcaagatctacaaaatgatgcag
ggaggagtgggcatccctaccatcagatggtgtggggctgagggggactacaatgtcatg
gtgatggagctactgggacccagcctggaagacctattcaacttctgttcaaggaagttt
agtctcaaaactgttctgttgcttgctgaccaaatgataagtcgtattgagtacattcat
tcgaagaattttatccaccgagacgtgaaaccagataacttcctcatggggctgggaaag
aaaggcaacctggtctacatcattgactttgggctggccaagaagtatcgggatgcccgc
acccaccagcatatcccctatcgagagaacaagaacctcacagggacagcacgctatgcc
tccatcaacacacaccttggcattgaacaatctcgaagggatgacttggagtctctgggg
tacgtgctgatgtacttcaacctgggctctctcccctggcaggggctgaaggccgccacc
aagaggcagaagtatgagaggatcagtgagaagaagatgtccactccaattgaagtgctg
tgcaagggctatccttctgaatttgccacatacctgaatttctgccgttccttacgtttt
gatgacaaacctgactactcctacctgagacagctcttcagaaatctgttccatcgccag
ggcttctcctacgactatgtgttcgactggaacatgctcaaatttggtgccagccgggct
gcagatgatgctgagcgggaacgccgggaccgagaagaacgattaagacactcccggaat
ccagccactcgtggcctcccttctacagcttccggccgtctgcggggaacccaggaagtg
gctcccccaacgccccttacccctacctcacatacggccaacacctctcctagacccgtc
tctggcatggaacgagaacggaaagtgagtatgcggctgcaccgtggggccccagtcaac
gtctcctcatctgatctcacgggccgacaagatacctctcgcatgtccacctcacagatt
cccggtcgggtggcttccagtggtcttcagtctgtcgtgcaccgatga

DBGET integrated database retrieval system