KEGG   Rattus norvegicus (rat): 64467Help
Entry
64467             CDS       T01003                                 

Gene name
Entpd2, Cd39l1, NTPDase2
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 2
  KO
K01509  adenosinetriphosphatase [EC:3.6.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    64467 (Entpd2)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    64467 (Entpd2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     64467 (Entpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 64467
NCBI-ProteinID: NP_742027
RGD: 69266
Ensembl: ENSRNOG00000013102
UniProt: O35795
Structure
PDB: 

Position
3p13
AA seq 495 aa AA seqDB search
MAGKLVSLVPPLLLAAAGLAGLLLLCVPTQDVREPPALKYGIVLDAGSSHTSMFVYKWPA
DKENDTGIVGQHSSCDVQGGGISSYANDPSKAGQSLVRCLEQALRDVPRDRHASTPLYLG
ATAGMRLLNLTSPEATARVLEAVTQTLTQYPFDFRGARILSGQDEGVFGWVTANYLLENF
IKYGWVGRWIRPRKGTLGAMDLGGASTQITFETTSPSEDPGNEVHLRLYGQHYRVYTHSF
LCYGRDQILLRLLASALQIHRFHPCWPKGYSTQVLLQEVYQSPCTMGQRPRAFNGSAIVS
LSGTSNATLCRDLVSRLFNISSCPFSQCSFNGVFQPPVTGNFIAFSAFYYTVDFLTTVMG
LPVGTLKQLEEATEITCNQTWTELQARVPGQKTRLADYCAVAMFIHQLLSRGYHFDERSF
REVVFQKKAADTAVGWALGYMLNFTNLIPADLPGLRKGTHFSSWVALLLLFTVLILAALV
LLLRQVRSAKSPGAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaagttggtgtcactggtgccacccctgctgctggctgccgcgggcctcgcc
ggccttctgctactttgcgtccctacccaagacgtccgggagccgcccgccctcaagtac
ggcattgtcctggatgcgggctcttcacacacatccatgtttgtctacaagtggccagcg
gacaaggagaatgacacaggcatcgtgggccagcacagctcttgtgatgttcaaggtggt
ggcatctccagctatgcaaatgacccctctaaggcaggccagagtctggtccgatgcctt
gagcaggcccttcgggatgtacccagagacagacatgctagcacaccactctacctggga
gctacagcaggcatgcgcctgctcaacctgaccagcccagaggccacagccagggtgctt
gaggcagtgacacagacgctcacacagtacccctttgacttccgtggtgctcgcatcctc
tcgggacaggatgaaggggtgtttggctgggtgactgccaactacctgctggagaacttc
atcaagtatggctgggtgggccggtggatacggccaaggaagggaacactgggggccatg
gaccttgggggtgcttcgacacagatcacctttgagacaaccagtccctctgaagatcca
ggcaacgaggttcatttgcgactctatggccagcattaccgcgtttacacacatagcttc
ctctgctatggccgagaccagattctcctgaggcttctggccagtgccctccagatccat
cgcttccacccctgctggccaaagggctactctacccaagtgctgctccaggaagtctac
cagtcgccatgcacgatgggtcagcgtccccgggccttcaatggcagtgccatcgtcagc
ctgtcaggaaccagcaatgctaccctgtgtcgtgacctcgtctctcggctcttcaacatc
tcctcctgccccttttcccaatgctccttcaatggggtcttccagcctcccgtgactgga
aacttcatagccttttctgctttctactatactgtggacttcctgacaacagtgatgggg
ctgcctgtgggaaccctgaagcagctggaggaagccacagagatcacctgcaaccagaca
tggactgaacttcaggcccgagtgccaggacaaaagacccgcctggctgactactgtgct
gtagccatgttcatacatcagcttctgagccgtggttaccacttcgatgagcgctccttc
agagaagtggtcttccaaaagaaggctgcagacacggctgtcggctgggcgctgggctac
atgctgaatttcactaacctgattcctgccgacctccccggactacgcaagggcacccac
ttcagctcctgggtcgctctcctgctgctcttcacagtcctgatcttggcggcgctggtc
ctgctcctgcgccaggtgcgttctgccaagtctccaggcgccctctag

DBGET integrated database retrieval system