KEGG   Rattus norvegicus (rat): 64471Help
Entry
64471             CDS       T01003                                 

Gene name
Plekhb1, Evt1, Kpl1
Definition
(RefSeq) pleckstrin homology domain containing B1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11
Motif
Other DBs
NCBI-GeneID: 64471
NCBI-ProteinID: NP_742030
RGD: 621614
Ensembl: ENSRNOG00000018627
UniProt: Q9WU68
Position
1q32
AA seq 223 aa AA seqDB search
MALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVVIHFNVRDIKVGQ
ECQDVQPPEGRSRDGLLTVNLREGSRLHLCAETRDDAIAWKTALMEANSTPAPAGATVPP
RSRRVCPKVRCTSLSWKPCKVERRIWVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYGP
GVTHVIVREDPCYSSGAPLAMGMLAGAATGAALGSLMWSPCWF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggccctggtgaggggcggctggctatggagacagagctccatcctccgccgctggaag
cggaattggtttgctctgtggttggatggcacgctgggttactaccacgatgagacggca
caggacgaggaggaccgtgtagttatccacttcaatgtccgagacataaaggtcggccag
gagtgtcaggatgtgcagcccccagagggcaggagccgagatggcctgctgacagtgaac
ctacgggagggttcccgcctgcacctgtgcgcagagacccgggatgatgccatagcatgg
aagacagccctgatggaggcaaactccaccccggccccagctggagccaccgtcccaccc
aggagccgtcgggtttgccctaaggtcaggtgtacgagcctctcatggaagccctgtaag
gttgagaggcggatctgggtacgcgtctacagtccatatcaagactactatgaggtggta
ccccccaacgcacacgaggccacgtatgtccgcagctactatgggccaccttatggtcct
ggtgtgacacatgtgatcgtgcgagaggatccctgctacagctctggcgcccctttggcc
atgggcatgcttgctggggctgccacgggtgctgcccttggctcacttatgtggtcgcct
tgctggttctga

DBGET integrated database retrieval system