KEGG   Rattus norvegicus (rat): 64472Help
Entry
64472             CDS       T01003                                 

Gene name
Naa35, Mak10, T4a
Definition
(RefSeq) N(alpha)-acetyltransferase 35, NatC auxiliary subunit
  KO
K20823  N-alpha-acetyltransferase 35, NatC auxiliary subunit
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64472 (Naa35)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   N-acetyl transferase complex C (NatC)
    64472 (Naa35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mak10 Rer1 EMC3_TMCO1
Motif
Other DBs
NCBI-GeneID: 64472
NCBI-ProteinID: NP_579858
RGD: 621771
Ensembl: ENSRNOG00000018417
UniProt: Q6DKG0
Position
17p14
AA seq 725 aa AA seqDB search
MVMKAAVDDDASGWELNVPEKMEKSSTSWVDITQDFEDACRELKLGELLHDKLFGLFEAM
SAIEMMDPKMDAGMIGNQVNRKVLNFEQAVKDGTIKIKDLSLPELIGIMDTCFCCLITWL
EGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAREKVNKAAAFEEEDFQSMTY
GFKMANGVTDLRVTGMLKDVEDDMQRRVKSTRSRQGEERDPEVELEHQQCLAAFSRVKFT
RVLLTVLIAFTKKETSAVAEAQKLMVQAADLLSAIHTSLHHGIQAQNGTTKGDHPIMMGF
EPLVNQRLLPPTFPRYAKIIKREEMVNYFSRLIDRIKTVCEVVNLPNLHCILDFFCEFSE
QSPCVLSRSLLQTTFLVDNKKVFGTHLMQDMVKDAPRSFVSPPVLSPKCCLYNNHQAKDC
IDSFVTHCVRPFCSLVQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHTMLLKQEP
QRQHLACLGTWVLYHSLRIMIQYLLSGFDLELYSMHEYYYIYWYLSEFLYAWLMSTLSRA
DGSQMAEERIMEEQQKGRSSKKTKKKKKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDG
KVRKPKFELDSEQVRYEHRFAPFNSVMTPPPVHYLQFKEMSDLSKYSPPPQPPELYVAAS
KHFQQAKMILESIPNADREVSRILKVAKPNFVVMKLLAGGHKKESKVPPEFDFSVHKYFP
VVKLV
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggttatgaaagccgcagtagatgatgacgcttcgggatgggagctcaatgtccctgag
aaaatggaaaaaagtagcacaagctgggtggacataacccaggactttgaagatgcttgt
cgagagctgaagttgggagaactgcttcacgataagctgtttggtctgtttgaagccatg
tctgctattgaaatgatggatcccaagatggatgccgggatgatcgggaaccaagtgaat
agaaaagtcctcaattttgaacaagccgtcaaggatggcaccattaaaattaaagacctc
agcttgcctgaactgataggaataatggatacctgtttttgctgtttgatcacatggctc
gaaggccattccttggcacagacggtatttacatgcctttacattcataatccagacttc
atagaagaccctgccatgaaagcttttgctctgggaatcttgaagatctgtgacattgca
agggaaaaagtcaacaaagctgctgcttttgaggaggaagatttccagtcaatgacatat
ggatttaaaatggccaacggtgtgacagatcttcgagttacagggatgctcaaagatgtg
gaggacgacatgcaaaggagagtaaagagtactcgaagtcgacaaggagaagagagagac
ccagaagttgaactagaacaccagcagtgcttggcagcgttcagcagagtgaagttcacc
cgagtactgctgacagtgctcatagccttcactaagaaagagaccagtgctgttgcagag
gctcagaaactgatggtccaggcggcagaccttctttctgccattcacacctcattgcac
cacggcatccaggctcagaatggcactaccaaaggagaccatccaattatgatgggtttt
gagccccttgttaaccagagattacttccacccaccttccctcgctatgcaaaaataatt
aaaagagaagaaatggtcaactatttctcaagattaatagacaggataaaaactgtctgt
gaagtcgtgaacttaccaaacttacattgtatcctggattttttctgtgaatttagtgaa
cagtcaccatgtgttctttcaagatctctgttacaaactactttcctcgtggataacaaa
aaagtctttgggactcatctcatgcaagacatggtgaaagatgctccccggtccttcgtc
agtcctccggtgctctcccccaagtgttgcctgtataataatcaccaggctaaggactgc
atcgactcctttgttactcactgtgttcggccattttgtagtcttgttcagatccatggc
cataacagggctcggcagagagacaaacttggtcacattcttgaagagtttgccaccttg
caagatgaggcagagaaggtcgatgcagcgctccacactatgttgttgaagcaggagcct
cagcgacagcatctggcctgtttaggaacttgggttctctaccacagcctgcggattatg
atccagtacctgctcagcggctttgatctggagctctacagcatgcacgagtactactac
atctactggtacctctctgagttcctgtacgcatggctgatgtcaaccctgagccgtgct
gacggctctcagatggcagaagagaggataatggaagaacagcagaaaggccgcagcagc
aagaaaacaaagaagaagaagaaagttcgtccattgagccgagagatcacaatgagccag
gcctatcagaacatgtgtgctgggatgttcaaaacgatggtcgcatttgacatggatggc
aaagtgcgcaagcccaaatttgagcttgacagtgagcaggtccggtatgagcacaggttt
gctccgttcaacagcgtgatgacgccaccaccagtgcactacctgcagttcaaggaaatg
tctgacctcagtaaatacagccctcctcctcagcctccagagctgtatgtggcagctagt
aagcactttcagcaggcaaagatgatccttgagagcatccccaatgcagaccgggaggtc
agcaggatcctaaaggttgccaagcctaactttgtggttatgaagctcttagcaggagga
cacaagaaagagtcaaaggttcctcctgaatttgatttctctgttcacaaatactttcct
gttgtgaaactggtttga

DBGET integrated database retrieval system