KEGG   Rattus norvegicus (rat): 64474Help
Entry
64474             CDS       T01003                                 

Gene name
Hdlbp
Definition
(RefSeq) high density lipoprotein binding protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: KH_1 SLS KH_2 DUF2067
Motif
Other DBs
NCBI-GeneID: 64474
NCBI-ProteinID: NP_742036
RGD: 620962
Ensembl: ENSRNOG00000031479
UniProt: Q3KRF2
Position
9q36
AA seq 1268 aa AA seqDB search
MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEP
AGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSLA
KDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHRFVIGKNGEKLQDLELKT
ATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGP
YNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAV
EVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAK
ANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVA
QEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNL
IRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEV
IINFPDPAQKSEIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKG
GANIKKIREESNTKIDLPAENSNSETIVITGKRANCEAARSRILSIQKDLANIAEVEVSI
PAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLA
EEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPAAEDKDQDLITIIGKE
DAVREAQKELEALIQNLDNVVEDYMLVDPRHHRHFVIRRGQVLREIAEEYGGVMVSFPRS
GTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTVECAIPQKFHRSVMGPKGSRIQQIT
RDYNVQIKFPDREENPVHSVEPSIQENGDEAGEGREAKETDPGSPRRCDIIVISGRKEKC
EAAKEALEALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSHTIAI
TGLAANLDRAKAGLLDRVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRL
EHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHA
RIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLAD
VVDSEALQVYMKPPAHEESKAPSKGFVVRDAPWTSNSSEKAPDMSSSEEFPSFGAQVAPK
TLPWGPKR
NT seq 3807 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgttgcagttttgacccaagagagttttgctgaacatcgaagtgggctggtt
ccacaacaaatcaaagttgccacattaaattcagaagaggaaagtgaccctccaacctac
aaggatgccttccctccactgcctgagaaagcagcttgcttggaaagtgcccaagaacct
gctggagcctggagtaacaagatccggcccatcaaggcctctgtcatcactcaggtgttt
catgtacccctggaggagagaaaatataaggacatgaaccagtttggagaaggtgaacaa
gcaaaaatctgccttgagatcatgcaaaggactggtgctcacctggagctctctctggct
aaagaccaaggtctctccatcatggtctcagggaagctggatgcagtcatgaaagcccgg
aaagacattgttgctagactacagacacaggcctcagccactgttcccattcctaaagag
caccaccgctttgttattggcaaaaacggagaaaaactacaagacttagaactgaaaact
gcaaccaaaatccagatcccacgcccagatgaccccagtaatcagatcaagatcactggc
accaaagaaggcatcgagaaagctcgccatgaggtccttctgatctctgctgagcaggac
aagcgtgccgtagagaggctagaagtggagaaggccttccaccccttcatcgctgggccg
tacaatagacttgtgggtgaaatcatgcaggagacagggacgcgaatcaacatccctcca
cccagtgttaaccgtacagaaatcgtcttcactggagagaaggaacagctggctcaggct
gtggctcgtattaagaagatttatgaggaaaagaagaagaagactacgaccattgcggta
gaggtgaagaaatctcagcacaagtatgtcatcgggccgaagggcaactcactgcaagag
atcctggaaagaactggagtctccgttgagatcccgccctcagacagcatctccgagact
gtgatacttagaggcgagcctgaaaagctgggacaggcattgactgaagtctatgccaag
gccaacagttttacagtctcctcagtctctgccccttcctggcttcaccgtttcatcatt
ggtaagaaagggcagaacctggccaaaatcactcagcaaatgccaaaggttcacattgag
ttcacagaaggtgaggacaagatcaccctggagggccccacagaagatgtgaatgtagcc
caggaacagattgaaggaatggtcaaagacctgattaatcggatggactatgtagagatc
aacattgaccataaattccacagacacctcattgggaagagtggagccaacatcaacaga
atcaaagaccagtacaaagtgtctgtgcgcatcccccctgacagcgagaagagtaacctg
atccgaattgagggagacccacaaggtgtgcaacaggccaagcgggagctgctggagctt
gcttctcgcatggaaaatgagcgcaccaaggatctaatcattgagcaaagatttcatcgc
acaatcattgggcagaaaggtgaacggattcgagaaattcgtgacaaattcccagaggtg
atcatcaactttccggatccagcacaaaagagtgagattgttcaactcagaggccccaag
aatgaggtggagaaatgtaccaagtacatgcagaaaatggttgcagacctggtggaaaat
agctattcaatttctgtaccgatcttcaaacagtttcacaagaatatcattgggaaagga
ggtgcaaacattaaaaagattcgtgaagagagcaacaccaagattgaccttcctgccgag
aacagcaactcggagaccattgtcatcactggcaagcgagccaactgtgaagccgcccgg
agccggatcctgtccatccagaaagatctggccaacatagctgaggtggaggtctcaatc
cctgccaaactacacaactctctcattggcaccaagggtcgtctgatccgctccatcatg
gaggaatgtggtggcgtccatattcactttcctgtggaaggttctggtagtgacactgtt
gtcatcaggggtccttcctcagatgtggagaaggccaagaagcagcttctgcacctggct
gaggagaagcaaaccaagagttttactgtggacatccgagccaagccagaataccacaaa
ttcctcattggcaaagggggaggtaaaatccgcaaggtgcgtgacagtactggagcccgc
atcatatttccggctgctgaggataaggaccaggacctgataacaatcataggaaaggaa
gatgctgtccgtgaggcacaaaaggagctggaagcattgatccagaacctggataatgtg
gttgaagactacatgctggtggaccccagacaccaccgccattttgttatccgaagagga
caggtattacgagagattgctgaagaatatggcggggtgatggtcagcttcccacgctct
ggcacacagagtgacaaagtcactctcaagggtgccaaagactgtgtggaggcagccaag
aagcgaattcaggaaatcattgaggatctggaagctcaagtaacggtggaatgtgctata
ccccagaagtttcatcgttcggtcatgggtcccaaaggttcaagaatccagcagatcact
cgggactacaatgttcaaattaagttcccagacagagaggaaaacccagttcacagtgta
gagccttccatccaggagaatggagatgaggctggagagggcagagaggccaaggagacc
gacccgggctctcccaggaggtgtgacatcatagttatctctggccggaaagagaaatgt
gaggctgccaaggaagccctggaggcactggttccagtcaccatcgaggtagaggtaccc
tttgatcttcaccgctacatcattgggcagaaaggaagtggaatccgcaagatgatggat
gagtttgaggtgaatatacatgtgccagcccccgaactgcagtcacacaccattgccatc
actggccttgcagcaaatttggacagggctaaggcggggctactggatcgagtaaaggag
ctgcaggctgagcaggaagatcgggctttaaggagttttaagctgagtgtcactgtagac
cccaaataccatcccaaaattatcgggagaaaaggggcagtgatcacacagatccgattg
gaacatgatgtgaacatccaatttcctgataaggacgatgggaatcagccccaggaccaa
atcaccatcacagggtatgagaagaacactgaagctgcccgtgatgctatcctgaaaatt
gtgggtgagcttgagcagatggtttctgaggatgttcccttggatcaccgtgtgcatgcc
cgaatcattggtgccagaggcaaagccatccggaaaatcatggatgagttcaaggtggac
attcgcttcccacagagcggagctccagaccctaactgcgtcactgtgacaggactcccg
gagaatgtggaggaagctatcgaccatatcctcaacctagaagaggaatatctggctgat
gtggtggacagtgaggcgctgcaagtttacatgaagcccccagcacatgaagagtccaag
gcaccatccaaaggctttgtggtgcgagatgctccctggacctccaacagcagtgagaag
gctcctgatatgagcagctctgaagaattccccagctttggggctcaagtggcccccaag
accctcccgtggggccccaaacgataa

DBGET integrated database retrieval system