KEGG   Rattus norvegicus (rat): 64507Help
Entry
64507             CDS       T01003                                 

Gene name
Fmod
Definition
(RefSeq) fibromodulin
  KO
K08121  fibromodulin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    64507 (Fmod)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    64507 (Fmod)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    64507 (Fmod)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_9 LRR_1 LRR_6
Motif
Other DBs
NCBI-GeneID: 64507
NCBI-ProteinID: NP_542429
RGD: 619769
Ensembl: ENSRNOG00000003183
UniProt: P50609
Position
13q13
AA seq 376 aa AA seqDB search
MQWASILLLRGLCSLSQGQYEEDSHWWLQYLRNQQSTYYDPYDTYPYETSDPYPYEVEEG
PAYAYGAPPPPEPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQIAAI
QEGVFDNATGLLWIALHGNQITSDKIGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRE
LHLDHNQISRVPNNALEGLENLTALYLHHNEIQEVGSSMRGLRSLILLDLSYNHLRRVPD
GLPSALEQLYLEHNNVYTVPDSYFRGSPKLLYVRLSHNSLTNNGLATNTFNSSSLLELDL
SYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVMNFSKLQVLRLDGNEIKRSAM
PVDAPLCLRLASLIEI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgggcctccatcctgctgctgcgcgggctctgctcgctttcccagggccagtat
gaagaagactctcactggtggctccaatacctccgaaaccagcagtccacctactacgac
ccctacgacacttacccctacgagacctccgacccttacccctatgaagtagaggagggc
ccagcctatgcctatggtgccccacctccaccagagccccgtgattgtccccaagaatgc
gactgtccccccaacttccccacagccatgtactgtgacaaccgcaacctcaagtacctg
ccctttgtgccctcccgcatgaagtacgtctacttccagaacaaccagatcgctgccatc
caggaaggtgtctttgacaatgccaccggcctcctctggattgctctgcatggcaaccag
attaccagtgacaagataggcaggaaggtcttctccaagctgaggcacttggagaggctg
tacctggaccacaacaacctgacccggatgcccggaccactgcctcggtccctgagagag
ctccacctggaccacaaccagatctctcgggtccccaacaacgctctggagggcctggag
aacctcacagcattatatctccatcacaatgagatccaagaagtgggaagttccatgagg
ggcctccggtccctgatcctactagacctgagttataaccaccttcgaagggttcccgac
ggtctgccctcagccctggagcagctgtacctagaacacaacaacgtctacaccgtccct
gacagctacttccggggctcacccaagctgctgtatgtccggctgtctcacaacagtctc
actaacaatggccttgctaccaacaccttcaattccagcagccttctggagctagacttg
tcctacaaccagctgcagaagatccctcccgtcaacaccaacctggagaatctttacctc
caaggcaacaggatcaatgagttctccatcagcagtttctgcacggtggtggacgtcatg
aacttctccaagctgcaggtgctacgcctggatgggaacgagatcaagcgcagcgctatg
ccggtggacgccccactctgcctgcgccttgccagcctcatcgagatctga

DBGET integrated database retrieval system