KEGG   Rattus norvegicus (rat): 64508Help
Entry
64508             CDS       T01003                                 

Gene name
Adcy3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04727  GABAergic synapse
rno04740  Olfactory transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04962  Vasopressin-regulated water reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05032  Morphine addiction
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    64508 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    64508 (Adcy3)
   04371 Apelin signaling pathway
    64508 (Adcy3)
   04020 Calcium signaling pathway
    64508 (Adcy3)
   04072 Phospholipase D signaling pathway
    64508 (Adcy3)
   04024 cAMP signaling pathway
    64508 (Adcy3)
   04022 cGMP-PKG signaling pathway
    64508 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    64508 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    64508 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    64508 (Adcy3)
   04062 Chemokine signaling pathway
    64508 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    64508 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    64508 (Adcy3)
   04912 GnRH signaling pathway
    64508 (Adcy3)
   04913 Ovarian steroidogenesis
    64508 (Adcy3)
   04915 Estrogen signaling pathway
    64508 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    64508 (Adcy3)
   04921 Oxytocin signaling pathway
    64508 (Adcy3)
   04926 Relaxin signaling pathway
    64508 (Adcy3)
   04935 Growth hormone synthesis, secretion and action
    64508 (Adcy3)
   04918 Thyroid hormone synthesis
    64508 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    64508 (Adcy3)
   04916 Melanogenesis
    64508 (Adcy3)
   04925 Aldosterone synthesis and secretion
    64508 (Adcy3)
   04927 Cortisol synthesis and secretion
    64508 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    64508 (Adcy3)
   04270 Vascular smooth muscle contraction
    64508 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    64508 (Adcy3)
   04971 Gastric acid secretion
    64508 (Adcy3)
   04972 Pancreatic secretion
    64508 (Adcy3)
   04976 Bile secretion
    64508 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    64508 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    64508 (Adcy3)
   04727 GABAergic synapse
    64508 (Adcy3)
   04725 Cholinergic synapse
    64508 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    64508 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    64508 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    64508 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    64508 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    64508 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    64508 (Adcy3)
   04714 Thermogenesis
    64508 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64508 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    64508 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    64508 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    64508 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64508 (Adcy3)
   05163 Human cytomegalovirus infection
    64508 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    64508 (Adcy3)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     64508 (Adcy3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N fn3_4 NCE101
Motif
Other DBs
NCBI-GeneID: 64508
NCBI-ProteinID: NP_570135
RGD: 71009
Ensembl: ENSRNOG00000003999
UniProt: P21932 G3V6I2
Position
6q14
AA seq 1144 aa AA seqDB search
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLMVAGVGLVLDII
LFVLCKKGLLPDRVSRKVVPYLLWLLITAQIFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDELEGMQLLREILANVFLYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTAQNGLNGSALPNGAPASKPSSPALIETKEPNGSAHASG
STSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQV
VKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLFCTAMVEILIDPWLMTNYV
TFVVGEVLLLILTICSMAAIFPRAFPKKLVAFSSWIDRTRWARNTWAMLAIFILVMANVV
DMLSCLQYYMGPYNVTTGIELDGGCMENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLL
VTGAVTAINLYAWCPVFDEYDHKRFQEKDSPMVALEKMQVLSTPGLNGTDSRLPLVPSKY
SMTVMMFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQV
VDNP
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctcggatcccgagtactcggcagagtactcagccgagtac
tcagtcagcttgccctctgaccccgaccgcggggtcggccggacccatgaaatttctgtg
cggaactctgggtcctgcctgtgcctgcctcgctttatgcggctgaccttcgtgcctgag
tccttggagaacctctaccagacctactttaaaaggcagcgccatgagacactgctggtg
ctggtggtctttgcggccctctttgactgctacgtggtagtgatgtgcgcggtggtcttt
tccagcgacaagctggcgcccctcatggtggcaggcgtcggtctggtgttggacatcatc
cttttcgtgctctgcaaaaaggggctgctcccggatcgagtgagccgcaaagtggtaccc
tacctgctgtggctgctcatcacagcccagatcttctcctacctgggcctgaacttttcg
cgtgcccacgcagccagtgacactgtgggttggcaggccttctttgtcttctccttcttc
ataacgctgccactcagcctcagccccatcgtgatcatctccgtggtctcctgtgttgtg
catacgcttgtcttgggggtcacggtggcccagcagcagcaagacgagctagaagggatg
cagctgctgagggagatcctggctaacgtcttcctctacctgtgcgccatcatcgtgggc
atcatgtcctactacatggcagaccgtaagcaccgaaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaatctggaggagcagagccagcagcaggaaaaccttatgctt
tccatcctgccaaagcatgtggctgacgagatgttgaaggacatgaagaaagatgagagt
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaatgtcagcatc
ctgtttgcagatattgtgggctttacccagctgtcctctgcttgcagtgcccaggagctc
gtgaagctactcaacgagctctttgcccgctttgacaagctggcggccaaataccaccag
ctgaggatcaagatcctaggcgactgttactactgcatctgcggcctgcctgactaccgg
gaggaccacgccgtgtgctccatcctgatggggcttgccatggtagaggccatctcgtac
gtgcgggagaagaccaagaccggagtggacatgcgtgtgggggtgcacacaggcactgtg
ctaggtggcgtcctgggccagaagcgctggcagtatgatgtatggtctaccgatgtcact
gtggcaaacaagatggaggctggcggcatcccagggcgcgtgcacatttcccagagcacc
atggactgcctgaaaggggagttcgatgtcgaacctggtgatggtggcagtcgctgcgac
tacctagatgagaagggcatcgaaacctacctcatcattgcctccaagccagaggtgaag
aagacagctcaaaatggcctcaacggctcggccctgccaaacggagcaccggcatccaag
cccagctcccctgcccttattgagaccaaggagcccaatgggagtgcccatgccagcggc
tccacatcagaggaggctgaagaacaggaggcccaggctgacaacccctcgttccccaac
ccccgccgcaggctgcgcctccaggacctggcagaccgtgtggtggacgcctctgaggat
gagcacgaactgaaccagcttcttaacgaggccctgctggagcgggagtccgcccaggtg
gtaaagaagagaaacacattcctcctaacgatgaggttcatggacccagagatggaaaca
cgctactcggtggagaaggagaagcagagtggggctgccttcagctgttcctgtgtggtc
cttttctgcacggccatggtggagatacttatcgacccctggttgatgacaaactacgtg
accttcgtggttggagaggttctgctcttgatcctgaccatctgttcgatggctgccatc
ttccccagggcatttcctaagaagctcgtggccttctcatcttggattgaccggacccgc
tgggccagaaatacctgggccatgttagccatcttcattctggttatggccaatgttgtg
gacatgctgagctgtctccagtactacatgggaccttacaacgtgacaaccgggatagag
ctggacggtggctgtatggagaaccccaagtactacaactatgttgctgtgctgtccctc
atcgccaccatcatgctggtgcaggtcagccacatggtgaagctgacactcatgctgctc
gtcacaggcgccgtgactgccatcaacctgtatgcctggtgtcctgtctttgatgaatac
gaccacaaacgctttcaggaaaaggactctcctatggtggccttagagaagatgcaggta
ctttccacccctgggctcaatggcactgacagcaggctgcccctggtgccttccaagtac
tcgatgactgtgatgatgttcgttatgatgctgagcttttactacttctcacgccacgtg
gagaaactggcccggacactgttcttgtggaagattgaggtccatgaccagaaagaacgt
gtgtacgagatgcgccggtggaacgaggccttggtcaccaacatgttgccagagcatgtt
gcacgccatttcctgggctccaagaagagagatgaggagctgtacagccagtcttatgac
gagattggagtcatgtttgcctccttgcccaactttgccgacttctacactgaggagagc
atcaataatggtggcatcgagtgtctacgcttcctcaatgagatcatctctgattttgac
tctctcctggacaatcccaaattccgggtcatcaccaagatcaaaaccatcggcagcacc
tatatggcagcttctggagtcacaccagatgtcaacaccaatggctttacaagctccagc
aaggaggaaaagtcagacaaggagcgctggcagcacctggctgacctggcagactttgca
ctagccatgaaggacacgcttacaaacatcaacaaccagtcattcaacaacttcatgctg
cgcataggcatgaacaaaggaggagttctggctggagtcattggagcccggaagccacac
tatgacatctgggggaacacggtcaatgtggccagcaggatggaatccacaggggtcatg
ggcaatatccaggtggtagaagagacacaggtcatccttcgagagtatggcttccgcttt
gtgaggcgaggacccatctttgtgaagggcaaaggggagcttctgacctttttcttaaag
gggcgggacaggccagctgccttccccaatggctcctctgttacactgccccaccaagtg
gtggacaacccctga

DBGET integrated database retrieval system