KEGG   Rattus norvegicus (rat): 64513
Entry
64513             CDS       T01003                                 

Gene name
Pawr, Par-4, Par4
Definition
(RefSeq) pro-apoptotic WT1 regulator
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: FPP ATG16 PRKG1_interact UPF0242 Stonin2_N DUF4589 Fib_alpha DUF724 Sod_Ni
Other DBs
NCBI-GeneID: 64513
NCBI-ProteinID: NP_277020
RGD: 69065
Ensembl: ENSRNOG00000005917
UniProt: Q62627
Structure
PDB: 
5FIY

Position
7q21
AA seq 332 aa
MATGGYRSSGSTTDFLEEWKAKREKMRAKQNPVGPGSSGGDPAAKSPAGPLAQTTAAGTS
ELNHGPAGAAAPAAPGPGALNCAHGSSALPRGAPGSRRPEDECPIAAGAAGAPASRGDEE
EPDSAPEKGRSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERK
REDAITQQNTIQNEAASLPDPGTSYLPQDPSRTVPGRYKSTISAPEEEILNRYPRTDRSG
FSRHNRDTSAPANFASSSTLEKRIEDLEKEVLRERQENLRLTRLMQDKEEMIGKLKEEID
LLNRDLDDMEDENEQLKQENKTLLKVVGQLTR
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcgaccggcggctatcggagcagcggcagcaccacggacttcctggaggagtggaaa
gcgaagcgcgagaagatgcgcgccaagcagaaccccgtgggcccgggttcgagcggcggg
gatccagccgccaagtcccctgcgggaccgctcgcccagactacggccgcggggacctcg
gaactcaaccacggccccgccggcgcggccgcacctgccgcccccgggccgggcgccctg
aactgcgctcacggctcgtccgcgctgccccgcggggctcccggctcccggcggccggag
gacgagtgtcctattgccgctggggccgcgggagcacccgcgtcccggggagacgaggag
gagccggatagcgccccggagaagggccgcagctcggggcccagcgccaggaaaggcaaa
gggcagatcgagaagaggaagctgcgggagaagcgccgctccaccggcgtggtcaacatc
cccgcggcggagtgcttagatgagtacgaagatgacgaagcaggacagaaggaacggaag
cgagaggatgctatcacacagcagaacaccatccagaatgaagctgcgagcctcccagat
ccaggaacctcctacctgccccaggacccgtcgagaacagtcccaggcagatacaaaagc
acaatcagtgccccagaagaagaaatcttaaatagatatccccgaacagatagaagtggc
ttcagtagacacaacagagataccagtgcgcctgctaacttcgcttcaagtagcaccttg
gaaaagagaattgaagatcttgagaaggaagtcttgagagaaaggcaagaaaaccttcga
cttacgaggctgatgcaagataaagaagaaatgattggaaaactcaaggaagagattgat
ttgttaaatagagacctcgatgacatggaagacgaaaacgagcaactaaagcaggaaaat
aaaactcttttgaaagttgttgggcagctgacaaggtag

DBGET integrated database retrieval system