KEGG   Rattus norvegicus (rat): 64514Help
Entry
64514             CDS       T01003                                 

Gene name
Eif2b1, eIF-2a
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit 1 alpha
  KO
K03239  translation initiation factor eIF-2B subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    64514 (Eif2b1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    64514 (Eif2b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    64514 (Eif2b1)
Translation factors [BR:rno03012]
 Eukaryotic Type
  Initiation factors
   eIF-2B
    64514 (Eif2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF-2B TPR_20
Motif
Other DBs
NCBI-GeneID: 64514
NCBI-ProteinID: NP_742026
RGD: 620819
Ensembl: ENSRNOG00000001039
Vega: OTTRNOG00000000116
UniProt: Q64270
Position
12q15
AA seq 305 aa AA seqDB search
MEDGELIKYFKSQMKGDPNMASAVAAIQTLLEFLKRDKGETIQGLRAHLTKAIETLCAVD
SSVAVSSGGELFLRFISLTSLEYSDYSKCKKIMIERGELFLSRISLSRTKIASLCHAFIK
DGARILTHAYSRVVLRVLEEAVAAKKRFSVYITESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKVDLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKSVQAGQDLKEEHPWVDYTSPSLITLLFTDLGVLTPSAVSDEL
IKLYL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaggacggtgagttaatcaagtactttaagtcccagatgaaaggagaccctaacatg
gcctcggcggtggctgccatccagaccttgctggaattcttgaagagagataaaggagag
acaatccagggcctgagagcccatctcaccaaagccatcgaaaccctctgcgctgtggac
tcctcggtggccgtgtcctcgggcggggaactcttccttcgcttcatcagcctcacctcc
ctggagtactccgactactccaaatgtaaaaagatcatgatcgagagaggagagcttttc
ctgagcagaatatccctgtcaagaactaagatcgccagtctatgccatgcttttatcaaa
gacggggcgagaatcttgactcacgcctactccagagttgtcctgagggtcctggaagaa
gccgtggcagccaagaaacgtttcagtgtgtatatcacggagtcacagcctgatttatct
ggtaagaaaatggccaaagccctctgccacctcaatgtccctgtcactgtggtgctggac
gctgctgttggctatatcatggagaaagtagaccttgtcatcgttggtgctgaaggagtg
gtagagaatggaggaattattaacaagatcggaaccaaccagatggccgtgtgtgccaaa
gcccagaacaagcccttctatgtggttgcagaaagtttcaagtttgtacggctctttcca
ctcaaccagcaagatgtcccagataagtttaagtacaaggcagacaccctgaagtctgtg
caggctggacaggacctcaaagaggaacacccatgggtcgactacacctccccatccctc
atcacactgctgtttacggacttaggtgtgttgacaccatccgctgtaagcgacgagctc
atcaagctgtacctgtga

DBGET integrated database retrieval system