KEGG   Rattus norvegicus (rat): 64517Help
Entry
64517             CDS       T01003                                 

Gene name
Thop1, EP24.15
Definition
(RefSeq) thimet oligopeptidase 1
  KO
K01392  thimet oligopeptidase [EC:3.4.24.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04614  Renin-angiotensin system
rno05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    64517 (Thop1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    64517 (Thop1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    64517 (Thop1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.15  thimet oligopeptidase
     64517 (Thop1)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M3
   64517 (Thop1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3
Motif
Other DBs
NCBI-GeneID: 64517
NCBI-ProteinID: NP_742072
RGD: 68330
Ensembl: ENSRNOG00000019924
UniProt: P24155
Position
7q11
AA seq 687 aa AA seqDB search
MKPPAACAGDVVDTVSPCSTVNHLRWDLSAQQIRALTTQLIEQTKCVYDRVGAQDFEDVS
YESTLKALADVEVTYTVQRNILDFPQHVSPNKDIRAASTEADKKLSEFDVEMSMRQDVYQ
RVVWLQEKIPKDSLKPEAARYLERLIKLGRRNGLHLPQDTQEKIKNIKKRLSLLCIDFNK
NLNEDTTFLPFTREELGGLPEDFLNSLEKTEDGKLKVTLKYPHYFPLLKKCHVPETRRLL
EEAFNCRCKEENCAILKELVSLRAQKSNLLGFRTHADYVLEMNMAKTSQTVATFLDELAR
KLKPLGEQERAVILELKEAECAKRGLPFDGRIHAWDMRYYMNQVEETRYRVDQNLLKEYF
PMQVVTRGLLAIYQELLGLTFTLEEGAAAWHEDVRLYSVRDAASGEEIGKFYLDLYPREG
KYGHAACFGLQPGCLRQDGSRQLAIAAMVANFTKPTPDVPSLLQHDEVETYFHEFGHVMH
QLCSQAEFAMFSGTHVERDFVEAPSQMLENWVWEKEPLMRMSQHYRTGGEAPEDLLEKLI
KSRQANAGLFNLRQIVLAKVDQVLHTQTDVDPAEEYARLCQEILGVPATPGTNMPATFGH
LAGGYDAQYYGYLWSEVYSMDMFHTRFKQEGVLSPKVGMDYRTSILRPGGSEDASTMLKQ
FLGRDPKQDAFLLSKGLQVEGCEPPAC
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccccgcagcctgtgctggggacgtggtggatacagtgtcaccatgctccacc
gtgaatcatctgcgctgggacctgagcgcacagcagatcagagctctaaccacacagctc
atcgagcagaccaagtgtgtgtacgaccgtgtgggcgcccaggacttcgaggacgtgtcc
tatgagagcacactgaaggcactggctgacgtggaggtcacctacacagtgcagaggaac
attctcgacttcccccagcacgtgtctccgaacaaggacatccgcgcagccagcacagag
gctgacaagaagctctcagagtttgatgtggagatgagcatgaggcaggacgtgtaccag
agggtcgtgtggctgcaggagaaaatcccgaaagactcactgaagcctgaggcagctcgc
tacctggagcggctcatcaagctgggccggagaaacgggctccacttacctcaggacaca
caggagaagatcaagaacatcaagaagaggctgagcctgctgtgcatcgacttcaacaag
aacctgaatgaggacaccaccttcctgcccttcacgagagaggagctgggcgggctcccc
gaggacttcctgaactccctggagaagacagaggacggcaaactgaaggtcaccctcaag
tatccacactatttcccactgctgaagaagtgccacgtgcccgagacacgacgcctgttg
gaggaggccttcaactgtcgctgcaaggaggagaactgtgccatcctgaaggagctagtg
tccctgcgggcgcagaagtccaacctgctgggattccgcacacacgcagactacgtcctg
gagatgaacatggccaagaccagtcagacagtagccaccttcctagatgaactggcccgg
aagctgaagccgctgggtgagcaggagcgtgcggtgatcctggagctgaaggaggcagag
tgcgccaagcgcgggctcccattcgatgggcgcatccacgcatgggacatgcggtactac
atgaaccaggtggaggagacacgctaccgcgtagaccagaacctgctgaaggagtacttc
cccatgcaggtggtcacgcgtgggctgctggccatctaccaagagctgctggggctgacc
ttcacgctggaggaaggtgccgccgcctggcacgaagacgtgcggctgtactctgtgcgt
gacgccgcctctggagaggagattggcaagttctacctcgacctgtaccccagggaaggg
aagtatggccacgcggcctgcttcggcctgcagcctggctgcctacggcaggatggcagc
cgacagctggccatcgcagccatggtggccaatttcaccaagcccacacctgacgtgcct
tccctgctgcagcacgatgaggtggagacctacttccacgagttcgggcacgtcatgcac
cagctctgctcacaggcagagtttgctatgttcagtgggacccacgtggagcgggacttt
gtggaggcaccgtcacagatgctggagaactgggtgtgggaaaaggagccactgatgcgc
atgtcccagcattaccgcacaggaggcgaggcccctgaggacctcctggagaagctcatc
aagtctcgccaggccaatgcaggtctcttcaaccttcggcagattgtccttgccaaggta
gatcaggtcctgcacacacagacagatgtagacccagctgaggaatatgcccggctctgc
caggagatccttggggtgccagccacaccaggtaccaacatgccagccacttttggccac
ctcgctggtggctacgacgctcagtactatggctacttgtggagtgaggtgtactccatg
gacatgttccacacacgcttcaagcaggagggtgtgcttagccccaaggttggcatggat
taccggaccagcatcctgaggccggggggctctgaggatgccagcaccatgctgaagcag
ttcctgggccgtgaccccaagcaagacgccttcctcctgagcaagggtctgcaggtagag
ggctgcgagccacctgcgtgctga

DBGET integrated database retrieval system