KEGG   Rattus norvegicus (rat): 64519Help
Entry
64519             CDS       T01003                                 

Gene name
Entpd1, NTPDase-1
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 1
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    64519 (Entpd1)
   00240 Pyrimidine metabolism
    64519 (Entpd1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    64519 (Entpd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    64519 (Entpd1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     64519 (Entpd1)
CD molecules [BR:rno04090]
 Proteins
  64519 (Entpd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 64519
NCBI-ProteinID: NP_072109
RGD: 69265
Ensembl: ENSRNOG00000014574
UniProt: F1M0G3
Structure
PDB: 

Position
1q54
AA seq 511 aa AA seqDB search
MEDIKDSKVKRFCSKNILIILGFSSVLAVIALIAVGLTQNKPLPENVKYGIVLDAGSSHT
NLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASK
QHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWI
TINYLLGRFTQEQSWLNFISDSQKQATFGALDLGGASTQITFVPLNSTLEAPETSLQFRL
YGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPC
TKRFEKKLPFNQFQVQGTGDYEQCHQSILKLFNNSHCPYSQCAFNGVFLPPLQGSFGAFS
AFYFVMDFFKKMANDSVSSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYI
LSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYIS
LMVLFSLVLVAMVITGLFIFSKPSYFWKEAV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggaagatataaaggattctaaggtgaagagattttgctccaaaaatattctgatcatc
cttggtttctcctctgtcttggctgtgatagctttgattgctgtgggactgacccagaac
aaaccattgccagaaaatgttaagtatgggattgtgctggatgccgggtcgtctcacacc
aacctgtacatctacaagtggccggctgagaaggagaatgatacaggagtggtgcagcag
ttagaagaatgccaagtgaaaggtcccggaatctcaaaatacgctcagaaaacagatgaa
atagctgcatatctggctgaatgcatgaaaatgtccactgagcggataccagcgtccaaa
cagcaccagacacccgtgtacctgggagccaccgcgggcatgcgcttgctcagaatggaa
agcaagcaatcggcagacgaagtcctggctgcagtgtcgaggagcctgaagagctacccc
tttgacttccagggcgccaagatcatcactgggcaggaggaaggggcctatgggtggatt
actattaactatctgctgggcagattcactcaggaacagagttggctaaacttcatctca
gacagccagaaacaggcaacctttggcgctttggatcttggcggagcttctacacagatc
accttcgtgcccctaaacagcactctagaggccccagaaacctccctgcagttccgtctc
tacggcacggactacaccgtgtacacacacagcttcctgtgctatgggaaggatcaggca
ctctggcagaaactggcccaggacattcaggtttcaagtggtgggattctcaaggacccg
tgcttttacccaggatataagaaggttgtgaatgtaagcgaactctatggcactccctgc
accaagagatttgagaagaagctaccgtttaatcagtttcaagtccagggcactggagac
tacgaacagtgccaccagagcatcctcaagctcttcaacaacagccactgcccttactcc
cagtgtgccttcaacggtgtcttcttaccacctctccaggggagttttggggcattttct
gctttctactttgtgatggacttttttaagaagatggcgaacgacagtgtctcctctcag
gagaaaatgactgagataacaaaaaacttttgctcaaagccttgggaggaggtaaaggca
tcttatcctacagtaaaggagaagtacctgagtgaatactgtttctcggggacctacatc
ctgtctctccttctgcaaggctataacttcacgggaacctcctgggaccagattcatttt
atgggcaagatcaaagacagcaacgcagggtggactttgggctacatgctgaacttgacc
aacatgatcccagctgaacagccattatccccgcctctccctcactccacctacatcagc
ctcatggttctcttctccctggtcttggtcgccatggtcatcacagggctgttcatcttt
agcaagccttcgtatttctggaaagaggcagtatag

DBGET integrated database retrieval system