KEGG   Rattus norvegicus (rat): 64520
Entry
64520             CDS       T01003                                 

Gene name
Mta1
Definition
(RefSeq) metastasis associated 1
  KO
K11660  metastasis-associated protein MTA
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    64520 (Mta1)
   03036 Chromosome and associated proteins [BR:rno03036]
    64520 (Mta1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    64520 (Mta1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    64520 (Mta1)
SSDB
Motif
Pfam: MTA_R1 BAH ELM2 GATA Myb_DNA-binding Myb_DNA-bind_7
Other DBs
NCBI-GeneID: 64520
NCBI-ProteinID: NP_072110
RGD: 621018
Ensembl: ENSRNOG00000004711
UniProt: Q62599
Position
6q32
AA seq 703 aa
MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSSLIALAD
KHATLSVCYRAGPGADTGEEGEVEEEVENPEMVDLPEKLKHQLRHRELFLSRQLESLPAT
HIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDL
LKDGEEDGRDQSKLETKVWEAHNPLVDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHM
SAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEAL
EKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYN
KPNPNQISVNSVKASVVNGTGTPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASC
WTYWKKYGGLKMPTRLDGERPGPNRNNMSPHGIPARSSGSPKFAMKTRQAFYLHTTKLTR
IARRLCREILRPWHAARHPYMPINSAAIKAECTARLPEASQSPLVLKQVVRKPLEAVLRY
LETHPRPPKPDPVKSSSSVLSSLTPAKSAPVINNGSPTILGKRSYEQHNGVDGLANHGQT
RHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLL
SSSETKRAARRPYKPIALRQSQALPLRPPPPAPVNDEPIVIED
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggccgccaacatgtacagggtcggagactatgtctactttgagaactcctccagcaac
ccgtacctgatccgcaggattgaagagctgaataagacagccaacgggaatgtggaggcc
aaagtggtgtgtttctacagaaggcgggacatttccagcagcctcatcgcgctggctgac
aagcatgcaaccctgtcagtctgctatagagccggaccgggggcggacaccggcgaggaa
ggggaagtggaggaggaggtagaaaacccagagatggtagacctgcctgagaaacttaag
caccagctgcggcatcgggaactgttcctctctcggcagttggagtctctgcctgccacc
cacatcaggggcaagtgcagtgttaccctgctcaatgagaccgagtcactcaagtcctac
ctggagcgtgaggatttcttcttctactctctagtctacgacccacagcagaagaccctc
ctggctgataaaggcgaaattcgtgtagggaaccggtaccaggctgacatcactgatttg
ctgaaagacggtgaggaggacggccgcgatcagtcgaagctggagaccaaggtgtgggaa
gcccacaatccacttgtagataagcagattgaccagtttctggtggtggcccgctctgtg
ggtacctttgcacgggccctggattgcagcagctccgtgcggcagcctagcctgcacatg
agtgccgccgcagcctcccgagacatcaccctgtttcatgccatggacacgctgcacaag
aacatctacgacatctccaaggccatctctgcccttgtgcctcagggtgggccagtgctc
tgcagggatgagatggaggagtggtcagcatcagaagccaacctttttgaggaagctctg
gaaaaatatgggaaagatttcacagacattcagcaagactttctcccatggaagtcgctc
accagcatcattgagtattactacatgtggaagaccaccgacagatacgtccagcagaaa
cgtttgaaagcagctgaagcagagagcaagttaaagcaggtttatattcccaactataac
aagccaaacccaaaccagatcagcgtcaacagtgtcaaggccagtgtagtgaatggcaca
gggacaccaggccagagccccggggccggtcgggcctgcgagagctgttacaccacacag
tcttaccagtggtattcttggggtccccctaacatgcagtgtcgcctctgcgcatcttgt
tggacatattggaagaaatatggtggcttgaaaatgccaacccggttagatggagagagg
ccgggaccaaaccgcaataacatgagtccccatggcatcccagctcggagcagtgggagc
cccaagtttgccatgaagacaaggcaggccttctacctgcatactaccaagttgacacgc
attgcccggcgcttgtgccgtgagatcctacgcccatggcatgccgcacgccacccctac
atgcccatcaacagtgcagcaatcaaggctgaatgcacagcacggctgcccgaagcttcc
cagagcccactggtgctgaagcaggtagtacggaagcccctggaggctgtgctccggtat
cttgagactcatccccgcccgcctaagcccgaccctgtgaagagctcatccagtgtgctc
agcagtctgacccctgccaagtcagcccctgtcatcaacaatggctcccctaccatcttg
ggcaagaggagctatgagcagcacaatggggtagatggtctggcaaaccatggacagacc
aggcacatgggaccaagtcggaatctcctgctcaatgggaagtcctaccccaccaaagtg
cgcctaatccgaggcggctccctgcctccagtcaagcggcggcggatgaactggattgac
gccccagatgatgtattttacatggccaccgaggagaccaggaaaatccgaaagctgctc
tcatcttcagaaaccaagcgtgctgcccgccggccctacaagcctattgccctgcgccag
agccaggccctgccgctgcggccacccccacctgcaccagtcaatgatgagcccattgtt
attgaggactag

DBGET integrated database retrieval system