KEGG   Rattus norvegicus (rat): 64525
Entry
64525             CDS       T01003                                 

Gene name
Eloc
Definition
(RefSeq) elongin-C
  KO
K03872  elongin-C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    64525 (Eloc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    64525 (Eloc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64525 (Eloc)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    64525 (Eloc)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    64525 (Eloc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    64525 (Eloc)
   03400 DNA repair and recombination proteins [BR:rno03400]
    64525 (Eloc)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     64525 (Eloc)
   ECS complex
     64525 (Eloc)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     64525 (Eloc)
SSDB
Motif
Pfam: Skp1_POZ
Other DBs
NCBI-GeneID: 64525
NCBI-ProteinID: NP_001257490
RGD: 620658
Ensembl: ENSRNOG00000031730
UniProt: P83941
Position
5
AA seq 112 aa
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
NT seq 339 nt   +upstreamnt  +downstreamnt
atggatggagaggagaaaacctatggtggctgtgaaggccctgatgccatgtatgtgaaa
ttaatatcttctgatggtcatgaatttattgtaaaaagagaacatgcattaacatcagga
acaataaaggccatgttgagtggtccaggtcagtttgcggagaatgaaaccaatgaggtc
aactttagagagatcccttcacatgtgctatcgaaagtgtgcatgtattttacctacaag
gtccgctatactaacagctccactgaaattcctgaattcccaattgcacctgaaattgca
ctggaactgctgatggccgcgaacttcctagattgttaa

DBGET integrated database retrieval system