KEGG   Rattus norvegicus (rat): 64527Help
Entry
64527             CDS       T01003                                 

Gene name
Pdap1, Haspp28, PAP
Definition
(RefSeq) PDGFA associated protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PP28 PACT_coil_coil
Motif
Other DBs
NCBI-GeneID: 64527
NCBI-ProteinID: NP_072117
RGD: 620442
Ensembl: ENSRNOG00000000990
Vega: OTTRNOG00000000691
UniProt: Q62785
Position
12p11
AA seq 181 aa AA seqDB search
MPKGGRKGGHKGRVRQYTSPEEIDAQLQAEKQKANEEDEQEEGGDGASGDPKKEKKSLDS
DESEDEDDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKA
KERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLN
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaggaggtagaaagggaggccataaaggccgagtgaggcagtatacaagccct
gaggagatcgatgcccagctacaggctgagaagcagaaggccaacgaagaagatgaacaa
gaagaaggtggagatggggcttcgggtgaccccaaaaaggagaagaaatctctagactca
gatgagagtgaagatgaagatgatgactaccagcaaaagcgaaaaggtgtggaagggctc
attgacattgagaaccccaaccgggtggcacagacgactaagaaggtgacacaactggat
ctggatgggccaaaggaactttcaaggagagaacgagaagaaatagagaagcagaaagca
aaagagcgctacatgaaaatgcatttggctgggaagacggagcaggccaaggctgatctc
gcccggctggcaatcatccggaaacagcgggaggaagcagcaagaaagaaagaagaagag
aggaaagcaaaagatgacgcaactttgtcaggaaaacgaatgcagtcgctctccctgaat
aagtaa

DBGET integrated database retrieval system