KEGG   Rattus norvegicus (rat): 64528
Entry
64528             CDS       T01003                                 

Gene name
Golga2, Gm130
Definition
(RefSeq) golgin A2
  KO
K20358  golgin subfamily A member 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64528 (Golga2)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    64528 (Golga2)
SSDB
Motif
Pfam: GOLGA2L5 GM130_C
Other DBs
NCBI-GeneID: 64528
NCBI-ProteinID: NP_072118
RGD: 620282
Ensembl: ENSRNOG00000011884
UniProt: Q62839
Position
3p12
AA seq 997 aa
MWPPRFPPPRPGMSEETRQSKLAAAKKKLREYQQKNSPGVPAGAKKKKKIKNGHSPERTS
ASDCQSAENVPTDHTAPAPPSTAAATMFLGVVPSPDADLIQSHDAGNCSNLMEETKTFSS
TESLRQLSQQLNGLVSESTSYINGEGLTSSNMKELESRYQELAVALDSSYVTNKQLSSTI
EELKQQNQDTLDQLEKEKKDYQQKLAKEQGALREQLQVHIQTIGILVSEKAELQTALAHT
QQAARQKAGESEDLASRLQSSRQRVGELERTLSTVSTQQKQADRYNKDLTKERDALKLEL
YKNGKSNEDLRQQNSELEEKLRVLVAEKAAAQLGAEELQKKLEMSELLLQQFSSQSEASG
SNEQLQQAMEERAQLESHVGQLMESLKQLQVERDQYAENLKGESAMWQQRVQQMAEQVHA
LKEEKEQRESQVQELEASLAELRSQMEEPPPPEPPTGPSEAEERLQGEVEQLQKELEGLT
GQLRAQVQDNESLSHLNREQEGRLLELEREAQHWSEQAEERKQILESMQSDRTTISRALS
QNRELKEQLAELQNGFVRLTNENMEITSALQSEQHVKKELARKLGELQERLGELKETVEL
KSQEAQGLQEQRDQCLSHLQQYAAAYQQHLTAYEQLTSEKEALHKQLLLQTQLMDQLQHE
EVQGKMAAEMARQELQEAQERLKASSQENQQLQAQLSLLVLPGEDMDQEEQDEEVPQPSL
TIPEDLVSREAMVAFCNAAIARAEEEQARLRVQLREQKARCRSLAHLAAPVQSKLEKEAV
VPRDMGDSVSEESNQALHVAMEKLQNRFLEVMQEKVELKERVEELEHCCIQLSGETDTIG
EYIALYQNQRAVLKARHLEKEEYISRLAQDKEEMKVKLLELQELVLRLVNERNEWQGKFL
AVSQNPADVPAPVPTGSQEFGAADQQDLREVSLADDTEPAQGEAGVPAPQENPTAQQIMQ
LLREIQNPQERPGLGSNPCIPFFYRADENDEVKIMVI
NT seq 2994 nt   +upstreamnt  +downstreamnt
atgtggcccccccgcttcccccctccccgccccgggatgtcggaagaaaccaggcagagc
aaattggctgcggccaagaaaaagctgagagagtatcagcagaagaacagcccgggtgtc
cctgcaggagcaaagaagaagaaaaagattaaaaatggccatagtccagagagaacctct
gccagtgattgtcagtcagcagagaatgtgcccacagaccacactgctcctgcaccacca
agtactgctgctgccactatgtttcttggtgtcgtcccttcccccgatgctgatctcatt
cagagccacgatgctggcaattgctctaacctcatggaggagaccaagactttctcatcg
actgagagtctgcgacaactttctcaacagctcaatggccttgtgtctgagtctacatcc
tacatcaacggggagggcctcacgtcttccaacatgaaggaactggagagccggtaccaa
gagctagcagtagccctggactccagctatgtaacaaacaaacaactcagtagcacgata
gaggaattgaagcaacagaaccaagacactctggatcaactggaaaaagagaagaaggat
tatcagcagaagctggcaaaggagcagggtgccctcagggaacaactgcaggttcacatt
cagaccataggcatcctggtgtctgagaaggcagaattacagacagctctggcccacact
cagcaagcagctaggcagaaagcaggagagtcggaggatcttgccagccgtctacagtcc
tcccgacagcgtgtgggagagctggagcggacgttgtctactgtgtcgacgcagcagaaa
caggcagacaggtacaacaaggacctaaccaaagagcgagacgccctcaagctggagcta
tacaagaatggcaaaagtaatgaggacctgaggcagcagaactcagaactggaagagaaa
cttcgagtcctggtggcagagaaagcagctgcacagttgggggcagaggagctgcagaag
aagttagagatgtcagagctgctgctgcaacagttctctagccaatctgaggcttctggc
agtaatgagcagttgcaacaggccatggaggagcgggctcagctggagagccatgttggc
cagctgatggagtcactgaaacagctccaggtggagagagaccagtacgcagagaacctg
aaaggagagagtgccatgtggcagcagagggtacagcagatggcagagcaggtgcacgca
ctgaaggaagagaaggagcagagagaaagtcaggtacaagagctggaggccagcttggct
gaactcaggagtcagatggaggagccaccacctccagagcctccaactgggccttcagag
gccgaagagcggctgcagggagaggttgagcagctgcagaaggaactggagggtctgacg
ggtcagctgcgggcccaggtgcaggacaatgagagcctgagccacctgaaccgggagcag
gagggacggctgctggagctggagcgcgaggcccagcactggagcgagcaggcagaggag
cgcaagcagatcctggagagcatgcagagtgaccgcaccaccatcagcagagcgctgtca
cagaatcgcgagctcaaggagcagctggctgagctgcagaacggcttcgtcaggctgaca
aatgagaacatggagattaccagtgcgttacaatcagagcagcatgtcaagaaagagctg
gccaggaagctgggagagcttcaggagaggctgggagagctgaaggagacggtggagctg
aagagccaagaagcacagggtctgcaggagcagcgagaccagtgcctgtcccacctgcag
cagtacgctgccgcctaccaacagcacttgacagcctatgagcagctgacctctgagaag
gaggcactgcacaagcagcttctgctgcagacacagctcatggaccagttgcagcatgag
gaagttcagggcaagatggcagccgagatggcccgccaggagctgcaggaggcacaggag
cgcctaaaagctagcagccaggagaaccaacagctccaagcccagctgagcctcttggtc
ctccctggggaagatatggaccaggaggagcaagacgaggaggttcctcagcccagtctg
accatcccagaagaccttgtcagtagagaggctatggtggccttctgcaatgcagcgata
gccagagctgaggaagagcaggcccgactccgcgtgcagctgagagagcagaaggcacgt
tgccggagcttggctcacttggcagccccagtccaaagcaagcttgaaaaggaggcagtg
gtccccagggatatgggtgactctgtatctgaggagagcaaccaggccctacatgtagcc
atggagaagctgcagaaccgcttcctggaggtcatgcaggagaaagtggagctcaaggag
cgggtggaggagcttgaacattgctgtatccagctttctggggagacagacactattgga
gagtacattgccctctaccaaaaccagagggcagtgctgaaggctcggcatttggagaag
gaagagtatatcagccggctggctcaggacaaggaggagatgaaggtaaaactgctagag
cttcaggagctggtgttgaggcttgtgaacgagcgcaatgaatggcagggcaagttcctg
gccgtgtctcagaaccctgctgatgtgcctgccccagtgcccacaggctcccaggaattt
ggcgctgctgaccagcaagacctcagggaggtgagcctggctgacgatacagagcctgca
caaggagaggcaggggtacccgctccccaggagaaccccactgcacaacagatcatgcag
ctgctgcgtgagatccagaacccccaggagcgcccaggcctgggtagcaacccttgcatc
ccctttttctaccgtgcggatgagaacgacgaggtgaaaatcatggttatataa

DBGET integrated database retrieval system