KEGG   Rattus norvegicus (rat): 64529
Entry
64529             CDS       T01003                                 

Gene name
Ctsb
Definition
(RefSeq) cathepsin B preproprotein
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04142  Lysosome
rno04210  Apoptosis
rno04612  Antigen processing and presentation
rno04621  NOD-like receptor signaling pathway
rno04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    64529 (Ctsb)
   04140 Autophagy - animal
    64529 (Ctsb)
  09143 Cell growth and death
   04210 Apoptosis
    64529 (Ctsb)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    64529 (Ctsb)
   04612 Antigen processing and presentation
    64529 (Ctsb)
  09152 Endocrine system
   04924 Renin secretion
    64529 (Ctsb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    64529 (Ctsb)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    64529 (Ctsb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64529 (Ctsb)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    64529 (Ctsb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     64529 (Ctsb)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   64529 (Ctsb)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   64529 (Ctsb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   64529 (Ctsb)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   64529 (Ctsb)
SSDB
Motif
Pfam: Peptidase_C1 Propeptide_C1
Other DBs
NCBI-GeneID: 64529
NCBI-ProteinID: NP_072119
RGD: 621509
Ensembl: ENSRNOG00000010331
UniProt: Q6IN22
Structure
PDB: 
1THE 1CTE 1CPJ 1MIR

Position
15
AA seq 339 aa
MWWSLIPLSCLLALTSAHDKPSFHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCG
TVLGGPKLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDR
ICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCL
PYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIM
AEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSW
NVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtggtggtccttgatccctctctcttgcctgctggcactgaccagtgcccatgacaag
ccttcctttcacccactgtcggacgacatgattaactatatcaacaaacagaatacaaca
tggcaggctggacgcaacttctacaatgttgacataagctatctgaagaagctgtgtgga
actgtcctgggtggacccaagctgccggaaagggttgggttcagcgaggacataaatcta
cctgaatcctttgatgcacgggaacagtggtccaattgcccgaccatcgcacagatcaga
gaccaggggtcctgtggctcttgttgggcatttggggcagtggaagccatgtctgaccga
atctgcattcacaccaatggccgagtcaatgtggaggtgtctgctgaggacctgcttacc
tgctgtggtatccagtgtggggatggctgtaatggtggctatccctctggagcatggaac
ttctggactagaaaaggcctggtttctggtggagtatacaattctcatataggctgctta
ccctacaccatccctccctgtgaacaccatgtcaatggctcccgtcccccatgcactgga
gaaggagatactcccaagtgcaacaagatgtgtgaggctggctactccacatcctacaag
gaagataagcactatgggtacacttcctacagtgtgtctgacagcgagaaggagatcatg
gcggaaatctacaaaaatggcccagtggagggtgcttttactgtgttttctgacttcttg
acttacaaatcaggcgtatacaagcatgaagccggtgatgtgatgggaggccatgccatc
cgcattctgggctggggaatagagaatggagtaccctactggctggtagcaaactcctgg
aacgttgactggggtgataatggtttctttaaaatcctcagaggagagaaccactgtgga
attgaatcagaaatcgtggctggaatcccacgcactcagcagtactggggaagattctaa

DBGET integrated database retrieval system