KEGG   Rattus norvegicus (rat): 64538Help
Entry
64538             CDS       T01003                                 

Gene name
Ilkap
Definition
(RefSeq) integrin-linked kinase-associated serine/threonine phosphatase
  KO
K17500  integrin-linked kinase-associated serine/threonine phosphatase 2C [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    64538 (Ilkap)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     64538 (Ilkap)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    64538 (Ilkap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C PP2C_2
Motif
Other DBs
NCBI-GeneID: 64538
NCBI-ProteinID: NP_072128
RGD: 620128
Ensembl: ENSRNOG00000020115
UniProt: Q9Z1Z6
Position
9q36
AA seq 392 aa AA seqDB search
MDLFGDLPEPERPPRPSAGKEAQEGPVLFEDLPPTSSTDSGSGGPLLFDGLPPAGSGNSG
SLATSGSQVVKNEGKGAKRKAPEEEKNGGEELVEKKVCKASSVIFGLKGYVAERKGEREE
MQDAHVILNDITQECNPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDV
ISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAI
LCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKR
CGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKPAVD
ARYEAACNRLANKAVQRGSADNVTVMVVRIGH
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggacctattcggggacttgccggagcccgagcgcccgccgcggccgtctgccgggaaa
gaagcacaggaaggacccgtgctcttcgaggacctgcccccgaccagcagtactgactca
ggatctgggggacctttactctttgatggtcttccacctgctggcagcggcaattcaggt
tctcttgccacatcaggctcccaggtggtgaagaacgaaggaaaaggagcaaagaggaaa
gcccctgaggaagagaagaatggcggtgaagagcttgtggaaaagaaagtttgtaaagcc
tcttcggtgatctttggtttgaaaggctacgtggcagagcggaagggtgagagggaggag
atgcaggacgcccatgtcatcctgaatgatatcactcaggagtgtaatcctccatcatct
ctcattactcgggtttcatactttgctgtttttgatggacatggaggaattcgagcctcg
aaatttgctgcacagaatttgcaccagaacttaatcaggaaatttcctaaaggagatgta
atcagtgtggagaagactgtgaagaggtgcctgctagatacttttaagcacaccgatgaa
gagttcctgaaacaggcttcaagccagaagcctgcctggaaagacgggtccactgccacg
tgtgtcctggctgtggacaacatcctgtatatcgccaaccttggagatagtcgggcaatc
ctgtgtcgatataacgaggaaagtcaaaagcatgcagccttaagcctcagcaaagagcac
aatccaactcagtatgaagagcgcatgaggatacagaaggctggaggcaatgtcagagat
ggccgtgtcttgggtgtgctggaggtatcccgctccattggagatgggcagtacaagcgt
tgcggggtcacatccgtgcctgatatcagacgctgccagttgacccccaatgacaggttc
attttgctggcttgtgatgggctcttcaaggtctttaccccagaagaagctgtgaacttc
atcttgtcctgccttgaggatgagaagatccagacccgagaagggaagcctgctgttgat
gcccgctatgaagctgcatgcaacaggctggctaacaaggcagtgcagcggggctcggca
gataacgtgacggtgatggtggtgaggataggacactga

DBGET integrated database retrieval system