KEGG   Rattus norvegicus (rat): 64545Help
Entry
64545             CDS       T01003                                 

Gene name
Icos, Ailim
Definition
(RefSeq) inducible T-cell co-stimulator
  KO
K06713  inducible T-cell co-stimulator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
rno04660  T cell receptor signaling pathway
rno04672  Intestinal immune network for IgA production
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    64545 (Icos)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    64545 (Icos)
   04672 Intestinal immune network for IgA production
    64545 (Icos)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    64545 (Icos)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    64545 (Icos)
CD molecules [BR:rno04090]
 Proteins
  64545 (Icos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set_2 Hum_adeno_E3A
Motif
Other DBs
NCBI-GeneID: 64545
NCBI-ProteinID: NP_072132
RGD: 620123
Ensembl: ENSRNOG00000046196
UniProt: Q9R1T7
Position
9q32
AA seq 200 aa AA seqDB search
MKPYFSCVFVFCFLIKLLTGELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDRE
VLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQ
EKNLSGGYLLIYESQLCCQLKLWLPVGCAAFVAALLFGCIFIVWFAKKKYRSSVHDPNSE
YMFMAAVNTNKKSRLAGMTS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctacttctcgtgcgtctttgtcttctgcttcctaatcaaacttttaacagga
gaactcaatgacttggccaatcacaggatgttttcgtttcacgatggaggtgtacagatt
tcttgtaactaccctgagactgtccagcagttaaaaatgcagttgttcaaagacagagaa
gtcctctgcgacctcaccaagaccaagggaagcggaaacaccgtgtccatcaagaatccg
atgtcctgtccatatcagctgtccaacaacagtgtctcttttttcctagacaacgcagac
agctcccagggcagctactttttatgcagcctgtcgattttcgacccacccccttttcaa
gaaaagaaccttagtggaggatatttgcttatttatgaatcccagctttgttgccagctg
aagctttggttacccgtagggtgtgcagcttttgtggcagcgctcctttttggatgcata
tttatcgtctggtttgcaaaaaagaagtacagatccagtgtgcacgaccctaatagcgag
tacatgttcatggcggcagtcaacacaaacaaaaagtccagacttgcaggtatgacctca
taa

DBGET integrated database retrieval system