KEGG   Rattus norvegicus (rat): 64546
Entry
64546             CDS       T01003                                 

Gene name
Il12b
Definition
(RefSeq) interleukin-12 subunit beta precursor
  KO
K05425  interleukin 12B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04620  Toll-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04940  Type I diabetes mellitus
rno05133  Pertussis
rno05134  Legionellosis
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05321  Inflammatory bowel disease
rno05330  Allograft rejection
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    64546 (Il12b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    64546 (Il12b)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    64546 (Il12b)
   04622 RIG-I-like receptor signaling pathway
    64546 (Il12b)
   04625 C-type lectin receptor signaling pathway
    64546 (Il12b)
   04658 Th1 and Th2 cell differentiation
    64546 (Il12b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64546 (Il12b)
   05205 Proteoglycans in cancer
    64546 (Il12b)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    64546 (Il12b)
   05164 Influenza A
    64546 (Il12b)
   05162 Measles
    64546 (Il12b)
   05168 Herpes simplex virus 1 infection
    64546 (Il12b)
  09171 Infectious disease: bacterial
   05133 Pertussis
    64546 (Il12b)
   05134 Legionellosis
    64546 (Il12b)
   05152 Tuberculosis
    64546 (Il12b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    64546 (Il12b)
   05145 Toxoplasmosis
    64546 (Il12b)
   05140 Leishmaniasis
    64546 (Il12b)
   05142 Chagas disease
    64546 (Il12b)
   05143 African trypanosomiasis
    64546 (Il12b)
  09163 Immune disease
   05321 Inflammatory bowel disease
    64546 (Il12b)
   05330 Allograft rejection
    64546 (Il12b)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    64546 (Il12b)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    64546 (Il12b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    64546 (Il12b)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    64546 (Il12b)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   64546 (Il12b)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Cytokines
   64546 (Il12b)
SSDB
Motif
Pfam: IL12p40_C Ig_3 Ig_5 Ig_2 Ig_4 fn3 ig
Other DBs
NCBI-GeneID: 64546
NCBI-ProteinID: NP_072133
RGD: 628704
Ensembl: ENSRNOG00000004380
UniProt: Q9R278
Position
10
AA seq 335 aa
MCHQKLTFSWFAMVLLVSPLMAMWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITW
TSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNF
KNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLN
QRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQ
VKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTS
AEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgtgtcatcagaagttaaccttctcctggtttgccatggttttgctggtgtctccactc
atggccatgtgggagctggagaaagatgtttatgttgtagaggtggactggcgccccgat
gcccctggagaaacggtgaccctcacctgtgacagtcctgaagaagatgacatcacctgg
acctcagaccagagacgtggagtcataggctctggaaagaccctgaccatcactgtcaga
gagtttctagatgctggccaatacacctgccacagaggaggcgagactctgagccactca
catctgctgctccacaagaaggaaaatggaatttggtccaccgagattttaaaaaatttc
aaaaataagactttcctgaagtgtgaagcaccaaactactccggacggttcacctgctca
tggctggtgcacagaaacacggacttgaagtttaacatcaagagcagcagcagttcccct
gagtctcgggcggtgacatgtggacgagcatctctgtctgcagagaaggtcacactgaac
caaagggactacgagaagtactcagtggcgtgccaggaggacgtcacctgcccaactgcc
gaggagaccctgcccattgaactggtggtggaggcccagcagcagaataaatatgagaac
tacagcaccagcttcttcatcagggacatcatcaaaccggacccacccaagaacctgcag
gtgaaacctttgaagaactctcaggtggaggtcagctgggagtaccctgactcctggagc
actccccattcctacttctccctcaagttcttcgtccgcatccagcgcaagaaagaaaag
acgaaggagacagaggaggagtgtaaccagaaaggtgcgttcctcgtagagaagacctct
gccgaagtccaatgcaaaggggcgaatatctgcgtgcaagcgcaggaccgctactacaat
tcatcatgcagcaaatggacatgtgtaccctgcaggggccgatcctaa

KEGG   Rattus norvegicus (rat): 84405
Entry
84405             CDS       T01003                                 

Gene name
Il12a
Definition
(RefSeq) interleukin-12 subunit alpha precursor
  KO
K05406  interleukin 12A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04620  Toll-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04940  Type I diabetes mellitus
rno05133  Pertussis
rno05134  Legionellosis
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05144  Malaria
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05321  Inflammatory bowel disease
rno05330  Allograft rejection
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    84405 (Il12a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    84405 (Il12a)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    84405 (Il12a)
   04622 RIG-I-like receptor signaling pathway
    84405 (Il12a)
   04625 C-type lectin receptor signaling pathway
    84405 (Il12a)
   04658 Th1 and Th2 cell differentiation
    84405 (Il12a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84405 (Il12a)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    84405 (Il12a)
   05164 Influenza A
    84405 (Il12a)
   05162 Measles
    84405 (Il12a)
   05168 Herpes simplex virus 1 infection
    84405 (Il12a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    84405 (Il12a)
   05134 Legionellosis
    84405 (Il12a)
   05152 Tuberculosis
    84405 (Il12a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    84405 (Il12a)
   05144 Malaria
    84405 (Il12a)
   05145 Toxoplasmosis
    84405 (Il12a)
   05140 Leishmaniasis
    84405 (Il12a)
   05142 Chagas disease
    84405 (Il12a)
   05143 African trypanosomiasis
    84405 (Il12a)
  09163 Immune disease
   05321 Inflammatory bowel disease
    84405 (Il12a)
   05330 Allograft rejection
    84405 (Il12a)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    84405 (Il12a)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    84405 (Il12a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    84405 (Il12a)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    84405 (Il12a)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   84405 (Il12a)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Cytokines
   84405 (Il12a)
SSDB
Motif
Pfam: IL12 MitMem_reg IL11
Other DBs
NCBI-GeneID: 84405
NCBI-ProteinID: NP_445842
RGD: 620562
Ensembl: ENSRNOG00000009468
UniProt: Q9R103
Position
2
AA seq 215 aa
MCQSRYLLFLATLVLLNHLTSARVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSC
TAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCL
GSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMG
EADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSS
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtgtcaatcacgctacctcctcttcttggccacccttgtcctcctaaaccacctcact
tcggccagggtcataccagtctctggacctgccaagtgtcttaaccagtcccaaaacctg
ctgaagaccacggacgacatggtgaggacggccagagaaaaattgaaacattactcttgc
actgctggagacatcgatcatgaagacatcacacgggacaaaaccagcacactggaggcc
tgcttaccactggaactccacaagaatgagagttgcctggctactaaagagacttcttcc
ataataagagggagctgcctgcctccacaaaagacttctttgatgatgaccctgtgcctt
ggtagcatctatgaggacttgaagatgtaccagtcagagttccaggccataaatgcagca
cttcagagccacaatcatcagcagatcactctggacagaaacatgctgatggctattgat
gagctaatgcggtctctgaatcacagcggcgagactctgcaccagaaagctcccatggga
gaagcagatccttacagagtgaagatgaagctctgtatcctgctccatgccttcagcacc
cgagtcatgactatcaacagggtgatgaactatctgagctcctcctaa

DBGET integrated database retrieval system