KEGG   Rattus norvegicus (rat): 64547
Entry
64547             CDS       T01003                                 

Gene name
Bcl2l11, Bim, BimL, Bod
Definition
(RefSeq) BCL2 like 11
  KO
K16341  Bcl-2-like protein 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04068  FoxO signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04932  Non-alcoholic fatty liver disease
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    64547 (Bcl2l11)
   04151 PI3K-Akt signaling pathway
    64547 (Bcl2l11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    64547 (Bcl2l11)
   04215 Apoptosis - multiple species
    64547 (Bcl2l11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64547 (Bcl2l11)
   05206 MicroRNAs in cancer
    64547 (Bcl2l11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    64547 (Bcl2l11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    64547 (Bcl2l11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    64547 (Bcl2l11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    64547 (Bcl2l11)
SSDB
Motif
Pfam: Bim_N Bclx_interact BMF PXT1
Other DBs
NCBI-GeneID: 64547
NCBI-ProteinID: NP_741985
RGD: 628774
Ensembl: ENSRNOG00000016551
UniProt: O88498
Position
3q36
AA seq 196 aa
MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPL
APPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
NHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMV
ILQLLRFIFRLVWRRH
NT seq 591 nt   +upstreamnt  +downstreamnt
atggccaagcaaccttctgatgtaaattctgagtgtgacagagaaggtggacaattgcag
cctgctgagaggcctccccagctcaggcctggggcccctacctccctacagacagaatcg
caaggtaatcccgacggcgaaggggaccgctgcccccacggcagccctcagggcccgctg
gccccaccggccagccctggtccttttgctaccagatccccacttttcatctttgtgaga
agatcttctctgctgtcccggtcctccagtgggtatttctcttttgacacagacaggagc
ccggcacccatgagttgtgacaagtcaacacaaaccccaagtcctccttgccaggccttc
aaccattatctcagtgcaatggcttccataaggcagtctcaggaggaacctgaagatctg
cgcccagagatacggatcgcacaggagctgcggcggatcggagacgagttcaatgagact
tacacgaggagggcgtttgcaaacgattaccgagaggcggaagaccacccgcaaatggtt
atcttacaactgttacgattcatcttccgtctggtctggagaaggcactga

DBGET integrated database retrieval system