KEGG   Rattus norvegicus (rat): 64549Help
Entry
64549             CDS       T01003                                 

Gene name
Inhbc
Definition
(RefSeq) inhibin beta C subunit
  KO
K22688  inhibin beta C chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    64549 (Inhbc)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    64549 (Inhbc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    64549 (Inhbc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    64549 (Inhbc)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   64549 (Inhbc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta XS
Motif
Other DBs
NCBI-GeneID: 64549
NCBI-ProteinID: NP_072136
RGD: 621194
Ensembl: ENSRNOG00000007700
UniProt: Q9WUK5
Position
7q22
AA seq 351 aa AA seqDB search
MASSLLLALLFLTLATVVNLKTDGPCPACWGATFDLESHRELLLDLAKKSILDKLHLSQR
PILSRPVSREALKTALRRLRGTRAETLLEHDQRQEYEIISFADTGLSNINQTRLEFHFSD
RTTGGVEVLQTRFMFFMQLPPNTTQTMNIRVLVLRPYDTNLTLTSQYMLQVDASGWYQLL
LGPEAQAACSQGHLTLELVPESQLAHSSLILDGVSHRPFVAAQVRVEGKHRVRRRGINCQ
GLSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNL
LKANTDAGTARRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctccttgctcctggctcttctgttcctgactctagccacagtagtgaacctc
aaaactgatggtccatgtccagcatgttggggtgccacctttgacctggagagccatcgg
gagctccttctcgatttggccaagaaaagcatcctggacaagctgcacctcagccagcgc
cccatactcagtcggcctgtgtccagagaggccctcaagaccgcgctgcggcgcctccgt
gggactcgagcggaaaccctgttggagcatgaccagagacaagaatatgagatcatcagc
tttgctgacacaggcctctccaacatcaaccaaacccgtcttgaattccatttctctgat
agaactactggtggtgtggaggtcctgcagacccgtttcatgttcttcatgcagctccct
cccaacaccacccagaccatgaatataagagttcttgtgctaaggccatatgacaccaac
ctcaccttgacaagccagtacatgctgcaggtggatgccagtggctggtaccagcttctc
ctaggacccgaagctcaagctgcttgcagtcaggggcacctcactctggagctggtgcca
gaaagtcagctggcccacagttccttgatcctggatggggtttcccacaggccttttgtg
gcagcccaggtaagagttgaaggcaagcatcgggtacgccggcgaggtatcaactgccag
gggctgtccaggatgtgctgtcggcaagagttctttgtggacttccgtgagattggctgg
catgactggatcatccagcccgaaggctatgccatgaacttctgcactgggcagtgccca
ctacatgtggcaggcatgcctggcatctctgcgtcctttcacactgcagtgctgaatctg
ctcaaagccaacacagatgctggcactgcccgcaggggctcatgctgcgtgcctacgtct
cggcgccctctgtctttgctctactatgacagggacagcaacattgtcaagacggatata
cctgacatggtggtagaggcctgtgggtgcagttag

DBGET integrated database retrieval system