KEGG   Rattus norvegicus (rat): 64550Help
Entry
64550             CDS       T01003                                 

Gene name
Top1, Ab2-086
Definition
(RefSeq) topoisomerase (DNA) I
  KO
K03163  DNA topoisomerase I [EC:5.6.2.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    64550 (Top1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     64550 (Top1)
DNA replication proteins [BR:rno03032]
 Eukaryotic Type
  DNA Topoisomerases
   64550 (Top1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Topoisom_I Topoisom_I_N Topo_C_assoc
Motif
Other DBs
NCBI-GeneID: 64550
NCBI-ProteinID: NP_072137
RGD: 621246
Ensembl: ENSRNOG00000047611
UniProt: Q9WUL0
Position
3q42
AA seq 767 aa AA seqDB search
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKDKDKDREKSKHSNSEHKDSE
KKHKEKEKTKHKDGSSDKHKDKHKDRDKEKRKEEKIRAAGDAKIKKEKENGFSSPPRIKD
EPEDDGYFAPPKEDIKPLKRPRDEDDADYKPKKIKTEDIKKEKKRKLEEEEDGKLKKPKN
KDKDKKVAEPDNKKKKAKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPEGV
KFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNDEKNTITNLS
KCDFTQMSQYFKAQSEARKQMSKEEKLKIKEENEKLLKEYGFCVMDNHRERIANFKIEPP
GLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTE
NIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVA
LYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFPGKDSIRYY
NKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITL
QQQLKELTAPDENVPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQSKIDAKKDQL
ADARKDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGT
SKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMTDEDYEF
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggaccatctccacaacgactcccagatcgaagcggatttccgattgaatgat
tctcataaacacaaagataaacacaaagatcgagaacaccggcataaggagcacaagaag
gataaggataaggaccgggaaaagtctaaacatagcaacagtgaacataaagattctgaa
aagaaacacaaagagaaagagaaaaccaaacacaaagatggaagctcagacaaacataaa
gacaaacataaagacagagacaaggaaaaacgaaaggaggaaaagattagagctgctggg
gatgcaaaaataaagaaggagaaggaaaatggcttctctagtccaccacgaattaaagac
gagcctgaagatgatggctattttgctcctccaaaagaggatataaagccactgaagagg
cctcgggatgaagatgatgctgattataagcctaagaaaattaagacagaagatatcaag
aaggagaagaaacgaaaactagaagaagaagaggatggcaaacttaaaaagcccaagaat
aaagataaagataaaaaggttgctgagccagataataagaagaagaaggcgaaaaaggaa
gaggagcagaagtggaaatggtgggaagaagaacgctatccagaaggcatcaagtggaaa
ttcctagaacataaagggcctgttttcgctccaccgtatgagcctctgccagagggtgtc
aagttttactatgatggtaaagttatgaagctgagtcccaaagcagaagaagtagctaca
ttctttgcaaaaatgcttgaccatgaatatactactaaggaaatattcaggaaaaatttc
tttaaagactggagaaaggaaatgactaatgatgaaaaaaatacgattaccaacctaagc
aaatgcgactttacacagatgagccagtacttcaaagctcaatcagaagctcggaaacag
atgagcaaggaagaaaaattgaaaatcaaagaagaaaatgaaaaattattgaaagaatat
ggcttttgtgtaatggataatcatagagagcggattgccaacttcaagatagagcctcca
gggctcttccgaggccgtggcaaccaccccaagatgggtatgctgaagagaaggatcatg
cctgaggacatcatcatcaactgtagcaaagatgccaaggttccttctcctcctcctgga
cataaatggaaggaagttcgacatgataacaaggttacttggctggtctcctggacagag
aatatccaaggttctatcaaatatatcatgctgaatcccagttcacgaatcaagggtgag
aaagactggcagaagtatgagactgctcggcgactgaagaagtgtgtggacaagatccga
aatcagtatcgggaagactggaagtccaaagaaatgaaagttcggcagagagctgtagca
ctgtacttcattgataagcttgctctgagagcaggcaatgagaaggaagaaggagagaca
gcagacactgtgggttgctgttcacttagagtggaacacatcaatctacacccagaattg
gatggtcaggagtacgtggtggagtttgactttcctgggaaggactcaatcagatactac
aacaaagtcccagttgagaaacgagtttttaaaaacttacaactatttatggagaacaag
cagcctgaggatgatctttttgatcgacttaatactggtattctaaataagcatcttcaa
gatctcatggagggcttgactgccaaggtgttccgtacctacaatgcctccatcacgctg
cagcagcagcttaaagagctcacagcccctgatgagaatgtaccagcaaagattctatct
tataaccgtgccaatcgcgctgttgcaattctttgtaaccaccagagggcgccaccaaag
acctttgagaagtcaatgatgaacttgcagtctaagattgatgccaagaaagatcagcta
gcagatgctcgaaaggacctgaaaagcgctaaggctgatgccaaagtcatgaaggatgca
aagaccaagaaggtagtagagtcaaaaaagaaggctgtacagagattagaagagcagctg
atgaagctggaggttcaagccacagaccgagaggagaacaaacaaattgccttggggacc
tccaaactcaattacctggaccctaggatcacagtggcttggtgcaaaaaatggggggtc
ccaatcgagaagatttacaacaaaacccagagagagaagtttgcttgggccattgatatg
actgatgaggactacgagttttga

DBGET integrated database retrieval system