KEGG   Rattus norvegicus (rat): 64564Help
Entry
64564             CDS       T01003                                 

Gene name
Bbox1, Bbh, Bbox
Definition
(RefSeq) gamma-butyrobetaine hydroxylase 1
  KO
K00471  gamma-butyrobetaine dioxygenase [EC:1.14.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    64564 (Bbox1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.1  gamma-butyrobetaine dioxygenase
     64564 (Bbox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TauD DUF971 CsiD Raf1_N
Motif
Other DBs
NCBI-GeneID: 64564
NCBI-ProteinID: NP_072151
RGD: 619756
Ensembl: ENSRNOG00000059519
UniProt: Q9QZU7
Position
3q34
AA seq 387 aa AA seqDB search
MHCAILKAEAVDGARLMQIFWHDGAESLYPAVWLRDNCQCSDCYLHSAKARKLLLEALDV
NIRMDDLTFDQKKVYITWPNGHYSEFEANWLKKRCFSQEARAGLQGELFLPECQYWGSEL
QLPTLNFEDVLNDDDHAYKWLSSLKKVGIVRLTGAADKRGEIIKLGKRIGFLYLTFYGHT
WQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQK
LKEKNPQAFSILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTVF
DVPIERVQPFYAALKEFVDLMNSKEYKYTFKMNPGDVITFDNWRLLHGRRSYEAGTEISR
HLEGAYADWDVVMSRLRILRQRVMNGN
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcactgtgccatcctaaaggcggaagcagtggatggggctcgcttgatgcagatcttt
tggcacgatggggcagagtccctctacccagcagtatggctcagagacaactgtcagtgt
tcggactgctatctacattctgcaaaagctcggaaacttctcctggaagctctcgatgtg
aacattagaatggatgacttgacatttgaccagaaaaaggtttatatcacttggcccaat
ggccattacagcgaatttgaagctaattggctgaagaaaagatgcttttctcaggaggcc
agagcaggactccaaggagaattatttttaccagaatgtcagtactggggctcagagctc
cagctgccaactctgaactttgaagatgtgttaaatgatgatgaccatgcatacaaatgg
ctttctagtctcaagaaagtaggcattgtgagactcactggagcagctgacaaacgtggc
gagatcataaaacttgggaaaagaattggctttctgtacctcacattttatggacacact
tggcaagtgcaggacaagattgatgccaacaatgtggcttatacaactgggaagctcagc
ttccacacagattacccagccctccaccatccacctggggttcagcttctgcactgtatc
aagcaaacagtcacaggaggtgactctgaaatcgtagatgggtttaatgtgtgccaaaaa
ctcaaggagaagaacccccaggctttttctattctctcctccacctttgtggattttaca
gacattggagtggattactgtgatttctctgtgcagtctaaacacaagattatagagctg
gatgataaaggccaagtggttcgcatcaacttcaacaacgcaaccagagatacagtcttc
gatgtccccattgaaagagttcagcctttctacgctgctctgaaggagtttgttgacctg
atgaacagcaaagaatacaagtacaccttcaagatgaatccaggtgatgtgattaccttt
gacaactggcgcttgcttcatggacgtcgcagctatgaagcaggaactgagatatcccgc
catctggaaggcgcttatgctgactgggatgtagtgatgtcaaggcttcgtattctgaga
cagagagtcatgaatgggaactga

DBGET integrated database retrieval system