KEGG   Rattus norvegicus (rat): 64574Help
Entry
64574             CDS       T01003                                 

Gene name
Chrna10
Definition
(RefSeq) cholinergic receptor nicotinic alpha 10 subunit
  KO
K04811  nicotinic acetylcholine receptor alpha-10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    64574 (Chrna10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    64574 (Chrna10)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   64574 (Chrna10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 64574
NCBI-ProteinID: NP_072161
RGD: 620142
Ensembl: ENSRNOG00000020293
UniProt: Q9JLB5
Position
1q32
AA seq 447 aa AA seqDB search
MGTRSHYLDLGFLLLLFLPAECLGAEGRLAHKLFRDLFANYTSALRPVADTDQTLNVTLE
VTLSQIIDMDERNQVLTLYLWIRQEWTDAYLHWDPKAYGDLDAIRIPSRLVWRPDIVLYN
KADTQPPASASTNVVVRHDGAVRWDAPAITRSSCRVDVSAFPFDAQRCGLTFGSWTHGGH
QLDVRPRGTSASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
CNLLLPCVFISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLILAESMPPAESVPLIGK
YYMATMTMVTFSTALTILIMNLHYCGPNAHPVPAWARVLLLGHLAKGLCVRERGEPCGQS
KPLESAPSLQPPPASPAGPCHEPRCLCHQEALLHHIASIASTFRSHRAAQRRHEDWKRLA
RVMDRFFLGIFFCMALVMSLIVLVQAL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggggacaaggagccactacctggacctggggtttctgctgctgctgtttctccctgca
gagtgcctgggagctgaggggagactggctcacaagctgtttcgtgacctgtttgccaac
tatacaagtgctctgagaccagtggcagatacagaccagactctaaatgtgaccctggag
gtgacattgtctcagatcattgatatggatgaacggaaccaggtgctgaccttgtacctg
tggatccggcaagagtggacagatgcctacctacactgggaccccaaagcctatggtgac
ctggacgcaatccgaattcccagccgtctagtgtggcgaccagacatcgtactttacaac
aaggcggacacgcagccacctgcctcagccagcaccaacgtggttgtgcggcacgacggc
gctgtgcgctgggacgcaccggccatcacacgcagctcgtgccgtgtggacgtgtctgcc
ttcccttttgacgcgcagcgctgcggcctgaccttcggctcatggacgcacggtgggcac
cagctggatgtgcgacctcggggcacttccgccagtctggccgacttcgtggagaacgtt
gaatggcgggtgctgggcatgccagcacgcaggcgggtcctcacctatggctgctgctct
gagccctacccagatgtgacctttactctgttgctgcgccgccgcgctgcagcctacgtg
tgcaacctcctgctgccctgtgtgttcatctccctgctggcgcctctggccttccacctg
cctgctgactctggggagaaggtgtctctgggcgtcaccgtgctcctggcgctcaccgtc
ttccagctgatcctggccgagagcatgccacctgcagagagtgtgccactcatcggaaag
tactatatggccactatgaccatggtcacattctccacagcacttaccatcctcatcatg
aatctgcactactgtggccctaatgcacatccagtgcccgcctgggctcgggttctcctg
ctgggacacctagccaaaggcctgtgtgtgcgggaacgaggggagccctgtgggcagtcc
aagccactagagtcagcccccagcctccagcctccaccagcttccccagcgggcccttgt
catgagccacggtgtctatgccaccaggaagcccttctacatcatatagcttccattgct
agtaccttccgcagccaccgggctgcccagcgccgccacgaagattggaagcgtctggct
agagtaatggaccgctttttcctaggcatcttcttctgcatggctctggtcatgagcctc
attgtactggtgcaagccctgtaa

DBGET integrated database retrieval system