KEGG   Rattus norvegicus (rat): 64621
Entry
64621             CDS       T01003                                 

Gene name
Akp3, Alpi2, IAP-2, IAP-II
Definition
(RefSeq) alkaline phosphatase 3, intestine, not Mn requiring
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00730  Thiamine metabolism
rno00790  Folate biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    64621 (Akp3)
   00790 Folate biosynthesis
    64621 (Akp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64621 (Akp3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    64621 (Akp3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     64621 (Akp3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   64621 (Akp3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  64621 (Akp3)
SSDB
Motif
Pfam: Alk_phosphatase SSP160
Other DBs
NCBI-GeneID: 64621
NCBI-ProteinID: NP_073171
RGD: 621650
Ensembl: ENSRNOG00000058652
UniProt: Q9JKS8
Position
9q35
AA seq 562 aa
MQGAWVLLLLGFRLQLSLSVIPVEEENPAFWNQKAADALNVAKKLQPIQTSAKNLIIFLG
DGMGVPTVTATRILKGQLEGNLGPETPLAMDHFPYMALSKTYSVDRQVPDSASTATAYLC
GVKTNYKTIGVSAAARFDQCNTTFGNEVLSVMYRAKKAGKSVGVVTTTRVQHASPAGTYV
HTVNRNWYGDADMPASALQEGCKDIATQLISNMDINVILGGGRKYMFPAGTPDPEYPNDV
NETGTRLDGKNLVQEWLSKHQGSQYVWNRQELIQKSLDPSVTYLMGLFEPVDTKFEIQRD
PLMDPSLKDMTEAALHVLSRNPKGFYLFVEGGRIDRGHHLGTAYLALTEAVMLDSAIERA
SQLTSEQDTLTIVTADHSHVFSFGGYTLRGTSIFGLAPLNALDGKPYTSILYGNGPGYVG
TGERPNVTDAESHDPSYQQQAAVPVKSETHGGEDVAIFARGPQAHLLHGVQEQNYIAHVM
AFAGCLEPYTDCGLAPPADENRPTTPVQNSTTTTTTTTTTTTTTTTTRVQNSASSLGPAT
GPLALALLAKALMLLLGAPADF
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgcagggcgcctgggtgctgctgctgctgggcttcaggctacaactgtcccttagcgtc
attccagtggaggaggagaacccagcattctggaaccagaaggcagccgatgccctgaat
gttgccaagaagctgcagcccattcagacgtcagccaagaacctcatcatcttcctgggt
gatgggatgggggtgcccacagtgacagctactcggatcctaaagggacagttggaaggt
aatctaggacctgagacacctctagccatggaccacttcccatatatggctctgtccaag
acatacagtgtggacagacaggtcccagacagtgcaagcacagccaccgcctacctatgt
ggggtcaagacgaactacaagaccattggtgtgagcgcggcagcacgatttgaccagtgc
aacaccacatttggcaacgaggtcctctctgtgatgtatcgtgccaaaaaagcaggaaaa
tccgtaggcgtggtgaccaccaccagggtgcagcacgcatctccagcaggcacctatgtt
cacactgtgaaccgcaattggtacggggatgcggatatgcctgcctctgcactgcaggag
ggctgcaaggacattgctacacaactcatctccaacatggacattaacgtgatccttggt
gggggccgaaaatacatgtttcctgcaggaaccccagaccctgagtatccgaatgatgtt
aatgagactggaaccagactggacggcaagaacctggtgcaggaatggctgtcaaagcac
cagggttcccagtatgtttggaatcgccaagagctcattcagaagtccctggatccatca
gtgacgtatctcatgggcctctttgagcctgtagacacaaaattcgagattcaacgagac
cccctgatggacccatctctgaaggatatgacagaggcagccctgcatgtgctaagcagg
aaccccaaaggcttctatctatttgtggaggggggccggatcgaccgcggtcaccatctg
ggcacagcttatctggcgctgactgaagctgtgatgctcgactcagccatcgagagggcc
agccagctcactagtgagcaggacactctgaccatagtcactgctgaccactcccatgtc
ttctcctttggtggctacacacttcgagggacctccatctttgggctggctcccctcaat
gctctggatggcaagccctacacctccatcctgtatggcaatggcccaggctatgtcggt
acaggggaaagacccaacgtcaccgatgctgaaagccatgacccatcgtaccagcagcag
gctgctgtgccggtgaagtcggagacccacggtggggaggacgtggctatattcgcacgt
ggcccgcaggcgcacttgctacacggagtgcaggaacagaactacatcgcgcacgtcatg
gccttcgcaggctgcctggagccctacaccgactgtggcctggcgccccctgcagacgag
aacagaccaaccaccccggtccagaacagcaccactaccaccaccaccaccaccaccacc
accaccaccaccactaccacccgggtccagaacagcgccagtagcctgggtccagccacc
ggcccactggccctggcactactggccaaggcgctgatgctactactgggggctcctgct
gatttctaa

DBGET integrated database retrieval system