KEGG   Rattus norvegicus (rat): 64625
Entry
64625             CDS       T01003                                 

Gene name
Bid
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04071  Sphingolipid signaling pathway
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04650  Natural killer cell mediated cytotoxicity
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05416  Viral myocarditis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    64625 (Bid)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    64625 (Bid)
   04215 Apoptosis - multiple species
    64625 (Bid)
   04217 Necroptosis
    64625 (Bid)
   04115 p53 signaling pathway
    64625 (Bid)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    64625 (Bid)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64625 (Bid)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    64625 (Bid)
   05161 Hepatitis B
    64625 (Bid)
   05160 Hepatitis C
    64625 (Bid)
   05164 Influenza A
    64625 (Bid)
   05162 Measles
    64625 (Bid)
   05168 Herpes simplex virus 1 infection
    64625 (Bid)
   05163 Human cytomegalovirus infection
    64625 (Bid)
   05167 Kaposi sarcoma-associated herpesvirus infection
    64625 (Bid)
   05169 Epstein-Barr virus infection
    64625 (Bid)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    64625 (Bid)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    64625 (Bid)
   05014 Amyotrophic lateral sclerosis
    64625 (Bid)
   05022 Pathways of neurodegeneration - multiple diseases
    64625 (Bid)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    64625 (Bid)
   05416 Viral myocarditis
    64625 (Bid)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    64625 (Bid)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    64625 (Bid)
SSDB
Motif
Pfam: BID DUF3517
Other DBs
NCBI-GeneID: 64625
NCBI-ProteinID: NP_073175
RGD: 620160
Ensembl: ENSRNOG00000012439
UniProt: Q9JLT6 A8ASI9
Position
4
AA seq 196 aa
MDSEVSNGSGLGAEHITNLLVFGFLRNNDRDFHQELEVLGQELPVQVYLEGDREDELQTD
GSRASRSFYHGRIEPDSESQDEVIHNIARHLAQAGDELDHSIQPTLVRQLAAQFMNGSLS
EEDKRNCLAKALDEVKTSFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFRTTVNFIN
QNLFSYVRDLVRNEMD
NT seq 591 nt   +upstreamnt  +downstreamnt
atggactctgaggtcagcaatggctcaggcctgggggctgagcacatcacaaacctgctg
gtgttcggctttctccgaaacaatgaccgtgatttccaccaagagctggaggtactgggg
caggagctgcccgtgcaggtttacctggagggggaccgtgaagacgagctgcagacagat
ggcagccgggctagccgctccttctatcatggaagaatagagccagattctgaaagtcag
gatgaagtcatccacaacattgccaggcatctcgcccaagcaggtgatgaactggaccac
agcatccagcccacactggtgagacaactggccgcacagttcatgaacggcagcctctcg
gaggaagacaaaaggaactgcctggccaaagccctcgacgaggtgaagacatccttccct
agggacatggagaatgacaaggccatgctgataatgaccatgctgttggccaaaaaagtg
gccagtcatgcaccatctctgctccgtgacgtcttccgcacgaccgtgaactttattaac
cagaacctattctcctacgtgagggacttggttagaaatgagatggactga

DBGET integrated database retrieval system