KEGG   Rattus norvegicus (rat): 64627
Entry
64627             CDS       T01003                                 

Gene name
Hist1h4b, H1ft, Hist4, Hist4h4
Definition
(RefSeq) histone cluster 1, H4b
  KO
K11254  histone H4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    64627 (Hist1h4b)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    64627 (Hist1h4b)
  09165 Substance dependence
   05034 Alcoholism
    64627 (Hist1h4b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    64627 (Hist1h4b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    64627 (Hist1h4b)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 64627
NCBI-ProteinID: NP_073177
RGD: 620814
Ensembl: ENSRNOG00000054017
UniProt: P62804
Position
17p11
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggccgaggcaaaggcgggaaaggcttgggcaaaggcggcgctaagcgccaccgc
aaagtcctgcgcgacaacatccagggcatcaccaagcccgccattcgccgcctggcccgg
cgcggaggagtgaagcgcatctccggcctcatctacgaggagacccgcggtgtgctgaag
gtgttcctggagaacgtgatccgcgacgccgtcacctacacggagcacgccaagcgcaag
accgtcaccgccatggacgtggtctacgcactcaaacgccagggccgtaccctctatggc
ttcggcggctaa

DBGET integrated database retrieval system