KEGG   Rattus norvegicus (rat): 64628Help
Entry
64628             CDS       T01003                                 

Gene name
Hes3
Definition
(RefSeq) hes family bHLH transcription factor 3
  KO
K09088  hairy and enhancer of split 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    64628 (Hes3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    64628 (Hes3)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    64628 (Hes3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Pou
Motif
Other DBs
NCBI-GeneID: 64628
NCBI-ProteinID: NP_073178
RGD: 621339
Ensembl: ENSRNOG00000010893
UniProt: Q04667
Position
5q36
AA seq 175 aa AA seqDB search
MEKKRRARINLSLEQLRSLLERHYSHQIRKRKLEKADILELSVKYVRSLQNSLQGLWLVP
SGVDYPSGFRGGLPGSSQRLRPGEDDSGLRCPLLLQRRAGSTTDSANPQTASVLSPCLPA
IWAPGPPAGGSQSPQSPFPPLGGLLESSTGILAPPPASNCQAENPRPGFRVWRPW
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaagcgtcgtgcccgcatcaacctgtcactggagcagctaaggtctcttctg
gagagacactactcccaccagatacggaagcgaaagctggagaaggccgatatcctggag
ctgagcgttaagtacgtgagaagcctccagaactcattgcaaggactttggctagtaccc
agtggggtggactacccgtccggattccgaggcggcttgccgggctccagccagaggctt
cggcccggagaggacgacagcggcctgcgctgccccctgcttctccagcgcagggcaggc
agcaccacggacagcgccaacccacagacggcctctgttctcagcccctgcctcccggcc
atctgggcccctggtccccctgcaggtggctcccaatccccgcagtccccgttccctccc
cttggaggtctccttgagtcctccactggcattctggcaccgccacctgcatcaaactgc
caggccgagaatccgagacccgggtttcgcgtgtggcggccctggtga

DBGET integrated database retrieval system