KEGG   Rattus norvegicus (rat): 64630
Entry
64630             CDS       T01003                                 

Gene name
Snap23
Definition
(RefSeq) synaptosomal-associated protein 23
  KO
K08508  synaptosomal-associated protein 23
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    64630 (Snap23)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    64630 (Snap23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64630 (Snap23)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64630 (Snap23)
Membrane trafficking [BR:rno04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-23
    64630 (Snap23)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64630 (Snap23)
  Exosomal proteins of other body fluids (saliva and urine)
   64630 (Snap23)
  Exosomal proteins of colorectal cancer cells
   64630 (Snap23)
SSDB
Motif
Pfam: SNAP-25 DUF5089 V-SNARE_C Use1 SOAR RmuC DUF1664 Sec20 COG6 TolA_bind_tri
Other DBs
NCBI-GeneID: 64630
NCBI-ProteinID: NP_073180
RGD: 620221
UniProt: O70377
Position
3q35
AA seq 210 aa
MDDLSPEEIQLRAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMD
QINKDMREAEKTLTELNKCCGLCVCPCNRTKNFESGKNYKATWGDGGDSSPSNVVSKQPS
RITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQN
QQIQKITEKADTNKNRIDIANTRAKKLIDS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggatgatctatcaccagaagaaattcagcttcgggctcaccaagttactgatgagtct
ctggaaagcacaaggagaatcctgggtttagccattgagtctcaggatgcaggaatcaag
actatcactatgctggatgagcaaggggaacaactaaatcgcatagaagaaggcatggac
caaataaataaagacatgagagaggcagagaagactttaacagaactcaacaagtgttgt
ggcctctgcgtctgcccttgtaataggaccaagaactttgagtctggaaagaactataag
gcaacatggggtgatggtggagacagctcacctagcaatgtggtatctaagcaaccaagc
cggataacaaatggtcagcctcagcagactacaggagcggccagcggtggatacattaaa
cgcataactaatgatgccagagaagatgagatggaagagaacctgactcaagtgggcagc
atcctagggaacctaaagaacatggctctggatatgggcaatgaaattgatgctcaaaac
cagcaaatacagaagatcacagaaaaggctgacaccaacaagaatcgcattgacattgcc
aatacaagagcaaagaaactcattgacagctaa

DBGET integrated database retrieval system