KEGG   Rattus norvegicus (rat): 64636Help
Entry
64636             CDS       T01003                                 

Gene name
Ntsr2
Definition
(RefSeq) neurotensin receptor 2
  KO
K04212  neurotensin receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    64636 (Ntsr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    64636 (Ntsr2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Neurotensin
    64636 (Ntsr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 64636
NCBI-ProteinID: NP_073186
RGD: 70962
Ensembl: ENSRNOG00000049054
UniProt: Q63384
Position
6q16
AA seq 416 aa AA seqDB search
METSSPWPPRPSPSAGLSLEARLGVDTRLWAKVLFTALYSLIFAFGTAGNALSVHVVLKA
RAGRPGRLRYHVLSLALSALLLLLVSMPMELYNFVWSHYPWVFGDLGCRGYYFVRELCAY
ATVLSVASLSAERCLAVCQPLRARRLLTPRRTRRLLSLVWVASLGLALPMAVIMGQKHEV
ESADGEPEPASRVCTVLVSRATLQVFIQVNVLVSFALPLALTAFLNGITVNHLMALYSQV
PSASAQVSSIPSRLELLSEEGLLGFITWRKTLSLGVQASLVRHKDASQIRSLQHSAQVLR
AIVAVYVICWLPYHARRLMYCYIPDDGWTNELYDFYHYFYMVTNTLFYVSSAVTPILYNA
VSSSFRKLFLESLGSLCGEQHSLVPLPQEAPESTTSTYSFRLWGSPRNPSLGEIQV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagcagtccgtggcctccgaggcccagccccagcgcagggctgagcctggag
gcgcggctgggcgtggacactcgcctctgggccaaggtgctgttcaccgcgctctactcg
ctcatcttcgcatttggcacagcgggcaatgcgctgtccgtgcacgtggtgctgaaggcg
cgggccggtcgccccgggcgcctgcgctaccacgtgctcagcctggcgctctcagccctg
ctgctactgctggtcagcatgcccatggagctctacaacttcgtgtggtcccactaccca
tgggtcttcggcgatctgggctgccgtggctattacttcgtgcgcgagctgtgcgcctac
gccacagtgctgagcgttgccagcctaagcgcagagcgctgcctggccgtgtgccagccg
ctgcgcgcccgccgccttctcaccccgcgccgcacccgccgcctgctgtcactggtctgg
gtcgcctctctgggccttgccctgcccatggcggttatcatgggacagaagcacgaagtg
gaaagcgcggacggggagcctgagcctgcctcgcgtgtgtgcacggtgctggtgagccgc
gccacacttcaggtcttcatccaggtgaatgtgctggtgtccttcgctctccccttggca
ctcactgctttcctgaatggcatcactgtcaaccacctgatggccctctactcccaggta
ccatcagcttctgcccaagtcagctccatccccagccgcctggagctcctgagtgaggaa
ggcctcctgggcttcatcacgtggagaaagactctctccctgggggtccaagccagcctg
gtgagacacaaggatgccagccagatccgcagcctccagcacagcgcccaggttctcaga
gccatcgtggctgtgtatgtcatctgctggctgccgtaccatgcccgccgactcatgtac
tgctacatccccgatgatggatggactaatgagctctatgatttctatcactatttctac
atggtgaccaacacgctcttctatgtcagctcagcagtgaccccaatcctctacaacgcc
gtgtcttcctccttcagaaagctcttcctggaatccctcggctccctgtgtggtgaacag
cactccttggtgcccttaccccaagaagccccagagtcaaccactagtacgtacagtttc
cggctttggggatccccaagaaaccccagcctgggagaaatacaagtatga

DBGET integrated database retrieval system