KEGG   Rattus norvegicus (rat): 64667
Entry
64667             CDS       T01003                                 

Gene name
Sgta, Stg
Definition
(RefSeq) small glutamine rich tetratricopeptide repeat containing alpha
  KO
K16365  small glutamine-rich tetratricopeptide repeat-containing protein alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64667 (Sgta)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64667 (Sgta)
SSDB
Motif
Pfam: TPR_1 SGTA_dimer TPR_2 TPR_8 TPR_11 TPR_17 TPR_16 TPR_7 TPR_14 TPR_10 TPR_12 TPR_19 TPR_9 TPR_6 NARP1 TOM20_plant BTAD DUF627
Other DBs
NCBI-GeneID: 64667
NCBI-ProteinID: NP_073194
RGD: 620815
Ensembl: ENSRNOG00000019891
UniProt: O70593
Position
7q11
AA seq 314 aa
MDNRKRLAYAIIQFLHGQLRHGGLSSDAQESLEVAIQCLETAFGVTLEDSDLALPQTLPE
IFEAATASKEMPQDPRGPDRTPPSEEDSAEAERLKTEGNEQMKLENFEAAVHLYGKAIEL
NPANAVYFCNRAAAYSKLGNYVGAVQDCERAIGIDPGYSKAYGRMGLALSSLNKHAEAVA
YYKKALELDPDNDTYKSNLKIAELKLREAPSPTGGVGSLDIAGLLNNPHFITMASSLMNS
PQLQQLMSGMISGGHNPLGTPGSSPQHSDLASLIQAGQQFAQQMQQQNPEFVEQIRSQVV
RSRTPSASHEEQQE
NT seq 945 nt   +upstreamnt  +downstreamnt
atggacaacaggaagcgcctggcctatgccatcatccagttcctgcatggccagctgcgg
cacggtgggctctcgtccgacgcccaggagagcctagaggttgccatccagtgtctggaa
acagcctttggggtgacgctggaggacagtgaccttgctctcccgcagaccctgccagag
atatttgaagcagccactgccagcaaggagatgccacaggacccgaggggccctgacagg
acaccaccctctgaggaggactcagctgaggcagagcgccttaaaacagaaggtaacgag
cagatgaagttggaaaactttgaggcagcagtgcacctctatggcaaagccattgagctc
aaccccgccaacgccgtttacttctgtaacagagctgcggcctacagcaagctgggaaac
tacgtgggggcggtacaggactgtgagcgcgccattggcattgatcccgggtacagcaag
gcctatggccgcatgggccttgcgctgtccagcctgaacaaacatgcggaggctgtggcg
tactacaagaaggccctggagctggaccctgacaacgacacgtacaagtccaacctcaag
atcgcagagctgaagttacgggaggcgccgagccctacgggcggcgtgggcagcttagac
atcgctggcctgctgaacaacccgcacttcatcactatggcttcgagcttaatgaacagc
ccccagctccagcagctcatgtcgggaatgatctctggaggccataaccctctgggcacc
ccaggcagcagtccacagcacagtgacctggccagtctcatccaggcgggccagcagttt
gcacagcagatgcagcagcagaacccagagttcgtggagcaaatccggagccaggtggtg
cgcagccggacacccagtgccagccacgaggagcagcaagagtga

DBGET integrated database retrieval system