KEGG   Rattus norvegicus (rat): 64672
Entry
64672             CDS       T01003                                 

Gene name
Pln
Definition
(RefSeq) cardiac phospholamban
  KO
K05852  phospholamban
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04919  Thyroid hormone signaling pathway
rno05414  Dilated cardiomyopathy
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    64672 (Pln)
   04024 cAMP signaling pathway
    64672 (Pln)
   04022 cGMP-PKG signaling pathway
    64672 (Pln)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    64672 (Pln)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    64672 (Pln)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    64672 (Pln)
   05415 Diabetic cardiomyopathy
    64672 (Pln)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    64672 (Pln)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   64672 (Pln)
SSDB
Motif
Pfam: Phospholamban Sarcolipin
Other DBs
NCBI-GeneID: 64672
NCBI-ProteinID: NP_073198
RGD: 619894
Ensembl: ENSRNOG00000000413
UniProt: P61016
Position
20
AA seq 52 aa
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
NT seq 159 nt   +upstreamnt  +downstreamnt
atggaaaaagtccaataccttactcgctcggctatcaggagagcctcgactattgaaatg
ccccagcaagcgcgtcagaacctccagaacctctttatcaatttctgtctcatcttgata
tgtctgctgctgatctgcatcattgtgatgcttctgtga

DBGET integrated database retrieval system