KEGG   Rattus norvegicus (rat): 64673Help
Entry
64673             CDS       T01003                                 

Gene name
Pip
Definition
(RefSeq) prolactin induced protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SVA
Motif
Other DBs
NCBI-GeneID: 64673
NCBI-ProteinID: NP_073199
RGD: 70946
Ensembl: ENSRNOG00000016076
UniProt: O70417
Position
4q24
AA seq 146 aa AA seqDB search
MQGLSFTSTAATFFLVLCLQLGINEGQDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQT
QYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDK
GICPNNVAVVPISGNRYFTDRTVYVN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtctctcattcacatccactgctgccaccttcttcttggtcctctgtctgcaa
ctggggatcaatgaaggccaggataatgaaactattccacagccacttttatttcaacta
aatgttccaagtacacctgacgaaaatcaggaggttgatatgtcacttactcttcaaaca
caatataaagaatgtctggtggtcaaagcttaccttataagtaatacaccggttgatggt
ggcttcaactatatacaaacacgctgcatctgcaatgatcatcctaccaccctttactgg
acttttgtagtcactcaaactttaacatttagaataatggttgacattgttaaggataaa
ggtatctgccctaataacgtcgcagtggtgcccatctcaggaaaccggtacttcacagac
cgtactgtgtacgtgaattaa

DBGET integrated database retrieval system