KEGG   Rattus norvegicus (rat): 64678
Entry
64678             CDS       T01003                                 

Gene name
Tfrc
Definition
(RefSeq) transferrin receptor protein 1
  KO
K06503  transferrin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04216  Ferroptosis
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    64678 (Tfrc)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    64678 (Tfrc)
   04145 Phagosome
    64678 (Tfrc)
  09143 Cell growth and death
   04216 Ferroptosis
    64678 (Tfrc)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    64678 (Tfrc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    64678 (Tfrc)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64678 (Tfrc)
   04090 CD molecules [BR:rno04090]
    64678 (Tfrc)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   64678 (Tfrc)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64678 (Tfrc)
  Exosomal proteins of colorectal cancer cells
   64678 (Tfrc)
CD molecules [BR:rno04090]
 Proteins
  64678 (Tfrc)
SSDB
Motif
Pfam: PA Peptidase_M28 TFR_dimer
Other DBs
NCBI-GeneID: 64678
NCBI-ProteinID: NP_073203
RGD: 70488
Ensembl: ENSRNOG00000001766
UniProt: Q99376
Position
11
AA seq 761 aa
MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAADEEENADSNMKASVRKPK
RFNGRLCFATIAVVIFFLIGFMIGYLGYCKRVEQKEECVRLAEAEEADKSENDETEYVPK
SSRLFWADLKTLLSEKLNSIEFTDIIKQLSQNTYTPREAGSQKDENLAYYIENLFHDFKF
SKVWRDEHYVKIQVKNSVSQNLVTINSGSNIDPVEAPEGYVAFSKAGEVTGKLVHANFGT
KKDFEELNYSVNGSLVIVRAGKITFAEKVANAQSFNAIGVLIYMDRNTFPVVEADLQFFG
HAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPSIPVQTISRAAAEKLFKNMEGNCPPSWNI
DSSCKLELSQNQNVKLTVNNVLKETRILNIFGVIKGYEEPDRYIVVGAQRDAWGPGVAKS
SVGTGLLLKLAQVFSDMISKDGFRPSRSIIFASWTAGDYGAVGATEWLEGYLSSLHLKAF
TYINLDKVVLGTSNFKVSASPLLYTLMGKIMQDVKHPIDGKYLYRDSNWISKIEELSLDN
AAFPFLAYSGIPAVSFCFCEDEDYPYLGTKLDTYEILIQKVPQLNQMVRTAAEVAGQFII
KLTHDIELTLDYEMYNSKLLSFMKDLNQFKADIKDMGLSLQWLYSARGDYFRATSRLTTD
FHNAEKTNRFVMREINDRIMKVEYHFLSPYVSPRESPFRHIFWGSGSHTLSALVENLRLR
QKNITAFNETLFRNQLALATWTIQGVANALSGDIWNIDNEF
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgatggatcaagccagatcagcattctctaacttgtttggaggggagccattgtcatac
acccggtttagccttgctcggcaagtagatggagataacagtcatgtggagatgaaactg
gctgcagatgaggaagaaaatgctgacagtaacatgaaggctagtgtcagaaaacccaaa
aggtttaatggaagactctgctttgcgactattgcagtagtcatcttttttttgattgga
tttatgatcggctacctgggctattgtaagcgcgtagaacaaaaagaggagtgtgtgaga
ctggctgaagcggaagaggcggacaagtcagaaaacgacgaaacagaatatgttcctaaa
tcttctcgcttattttgggcagacctcaaaacactgttgtcagagaaattgaattccata
gagttcactgacatcatcaagcagctgagccagaatacatatactcctcgtgaggctgga
tctcagaaagacgagaatcttgcctattatattgaaaatctgttccatgactttaaattc
agcaaagtctggcgagatgaacattatgtgaagattcaagtgaaaaacagtgtttctcaa
aacttggtgaccataaattcaggtagtaacattgacccagtggaggctcctgagggttat
gtggcatttagtaaagctggagaagttactggtaaactggtccatgctaattttggcact
aaaaaggactttgaagaattaaattattctgtgaatggatctttagtgattgttagagca
gggaaaattacttttgcagaaaaggttgcaaatgcccaaagctttaatgcaattggtgtc
ctcatctacatggacaggaatacgttccccgttgttgaggcagaccttcaattctttgga
catgctcatctaggaactggggatccatatacacctggctttccttctttcaaccatact
cagtttccgccatctcagtcatctggattgccttctatacctgtgcagacgatctcaaga
gctgctgcagaaaagctattcaaaaacatggaaggaaactgtcctcctagttggaatata
gattcctcatgtaagctggaactttcacagaatcaaaatgtgaagctcactgtgaacaat
gtactgaaagaaacaagaatacttaacatctttggcgttattaaaggctatgaggaacca
gaccgctacattgtagtaggagcccagagagacgcttggggccctggtgttgcgaagtcc
agtgtgggaacaggtcttctgttgaaacttgcccaagtattctcagatatgatttcaaaa
gatggatttagacccagcaggagtattatctttgccagctggactgcaggagactatgga
gctgttggtgccactgagtggctggaggggtacctttcatctttgcatctaaaggctttc
acttacattaatctggataaagtcgtcctgggtactagcaacttcaaggtttctgccagc
cccctattatatacacttatggggaagataatgcaggacgtaaagcatccgattgatgga
aaatatctatatcgagacagtaattggattagcaaaattgaggaactttccttggacaat
gctgcattcccttttcttgcatattcaggaatcccagcagtttctttctgtttttgtgag
gatgaggactatccttatttgggcactaaactagatacctatgagatattaattcagaaa
gttcctcagctcaaccaaatggttcgtacagcagcagaggtggccggtcagttcattatt
aaacttacccatgacattgagttgaccctggactatgagatgtacaacagcaaactactg
tcatttatgaaggatctgaaccagttcaaagcagatatcaaagatatgggtctaagtcta
caatggctgtattctgctcgtggagactacttccgtgctacttctagactaacaactgat
tttcataatgctgagaaaacaaacagattcgtcatgagggaaatcaatgatcgtattatg
aaagtggagtatcacttcctgtcaccctatgtatctccaagagagtctcctttccgacac
atcttctggggctctggctctcacaccctctcagctttagtggagaacctgagacttcgt
cagaaaaatatcactgctttcaatgaaacgctcttcagaaaccagttggccctggctacg
tggactattcagggagttgcaaatgccctctctggtgacatttggaatattgacaatgag
ttttaa

DBGET integrated database retrieval system