KEGG   Rattus norvegicus (rat): 64680
Entry
64680             CDS       T01003                                 

Gene name
Crhr2, CRF-R_2, CRH-R_2, Crf2r
Definition
(RefSeq) corticotropin releasing hormone receptor 2
  KO
K04579  corticotropin releasing hormone receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    64680 (Crhr2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    64680 (Crhr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    64680 (Crhr2)
G protein-coupled receptors [BR:rno04030]
 Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone (CRH)
    64680 (Crhr2)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 64680
NCBI-ProteinID: NP_073205
RGD: 70547
Ensembl: ENSRNOG00000011145
UniProt: P47866
Position
4q24
AA seq 411 aa
MDAALLLSLLEANCSLALAEELLLDGWGEPPDPEGPYSYCNTTLDQIGTCWPQSAPGALV
ERPCPEYFNGIKYNTTRNAYRECLENGTWASRINYSHCEPILDDKQRKYDLHYRIALIIN
YLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNITWFLLQLIDHEVHEGN
EVWCRCVTTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIV
AWAVGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS
ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYC
FFNGEVRSALRKRWHRWQDHHALRVPVARAMSIPTSPTRISFHSIKQTAAV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggacgcggcgctgctcctcagcctgctggaggccaactgcagcctggcactggccgaa
gagctgcttttggacggctggggagagcccccggaccccgaaggtccctactcctactgc
aacacgaccttggaccagatcgggacctgctggccccagagcgcgcctggagccctagtg
gagagaccatgccccgaatacttcaacggcatcaagtacaacacgacccggaatgcctac
agagaatgcctggagaatgggacctgggcctcaaggatcaactactcacactgtgaaccc
attttggatgacaagcagaggaagtatgacctgcattaccgaatcgccctcatcatcaac
tacctgggccactgtgtttccgtggtggccctggtggctgctttcctgcttttcctagtg
ctgcggagtatccgctgcctgcggaatgtgatccactggaacctcatcaccaccttcatc
ctgagaaacatcacgtggttcctgctgcaactcatcgaccacgaagtgcatgagggcaat
gaggtctggtgccgctgcgtcaccaccatattcaactactttgtggtcaccaacttcttc
tggatgtttgtggaaggctgctacctgcacacggccatcgtcatgacgtactccacggag
catctgcgcaagtggctcttcctcttcattggatggtgcataccctgccctatcattgtc
gcctgggcagttggcaaactctactatgagaatgagcagtgctggtttggcaaggaacct
ggtgacttagtggactacatctaccagggccccatcatcctcgtgctcctcatcaatttt
gtgtttctgttcaacatcgtcaggatcctgatgacaaaactgcgagcctccaccacatcc
gagaccatccagtacaggaaggcagtgaaggccaccctggtcctcctccccctgttgggc
atcacctacatgctcttctttgtcaatcctggagaggacgacctgtcacagattgtgttc
atctacttcaactctttcctgcagtcctttcagggtttctttgtgtccgttttctactgc
ttcttcaatggagaggtgcgctccgccctgagaaagcggtggcaccgttggcaggaccac
cacgccctccgagtgcctgtggcccgggccatgtccattcccacatcgcccaccaggatc
agcttccacagcatcaagcagacagctgccgtgtga

DBGET integrated database retrieval system