KEGG   Rattus norvegicus (rat): 64701
Entry
64701             CDS       T01003                                 

Gene name
Rpn2
Definition
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 precursor
  KO
K12667  oligosaccharyltransferase complex subunit delta (ribophorin II)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00510  N-Glycan biosynthesis
rno00513  Various types of N-glycan biosynthesis
rno01100  Metabolic pathways
rno04141  Protein processing in endoplasmic reticulum
Module
rno_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    64701 (Rpn2)
   00513 Various types of N-glycan biosynthesis
    64701 (Rpn2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    64701 (Rpn2)
SSDB
Motif
Pfam: Ribophorin_II HSM3_N DUF1569 DUF5859
Other DBs
NCBI-GeneID: 64701
NCBI-ProteinID: NP_113886
RGD: 62075
Ensembl: ENSRNOG00000007492
UniProt: P25235
Position
3
AA seq 631 aa
MAPPGSSAVFLLALTITASTQALTPTHYLTKHDVERLKASLDRPFTSLESAFYSIVGLNS
LGAQVPDVKKACAFIKSNLDPSNVDSLFYAAQSSQVLSGCEISVSNETRDLLLAAVSEDS
SVAQIYHAVAALSGFGLPLASHEALGALTARLSKEETVLATVQALHTASHLSQQADLRNI
VEEIEDLVARLDELGGVYLQFEEGLELTALFVAATYKLMDHVGTEPSIKEDQVIQLMNTI
FSKKNFESLSEAFSVASAAAALSQNRYHVPVVVVPEGSASDTQEQAILRLQVSSVLSHAL
AQAAVKLEHAKSVASRATVLQKMPFSLVGDVFELNFKNVKLPSGYYDFSVRVEGDNRYIA
NTVELRVKISTEVGITNADLSTVDKDQSIPPKTTRVTYPAKAKGTFIADSHQNFALFFQL
VDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVHKFELDTSERKIEFDSASGTYT
LYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTV
VSNTFTALILSPLLLLFALWIRIGANVSNFTFAPTTIIFHLGHAAMLGLMYVYWTQLNMF
QTLKYLAVLGTVTFLAGNRMLAQQAVKRTAH
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggcgccgccgggttcaagtgctgtcttcctgttggccctgacaatcacagccagcacc
caggctctgacccccacccactacctcaccaagcatgatgtggaaagactgaaagcctca
ctggatcgccctttcacgagcttggagtctgccttctactccattgtgggactcaacagc
cttggggcacaggtgccagatgtcaagaaagcgtgtgccttcatcaagtcaaaccttgat
cccagcaacgtggattctctcttctatgctgcccaatccagccaagtcctctcaggttgt
gagatatctgtttcgaatgagaccagagatctgcttctggcagcagtcagcgaggactcc
tccgttgcccaaatctaccatgcagttgccgccctcagtggctttggtcttcccttggca
tcccatgaagcccttggtgcccttaccgctcgcctcagcaaggaggagactgtgctggca
accgtccaggctctgcacacagcatcccacctatcccagcaggctgacctgaggaacatt
gtagaagagatcgaggaccttgttgctcgcctggacgaactagggggtgtgtatctccag
tttgaggaaggcctggaacttacagcattgtttgttgctgccacctacaagctcatggac
catgtggggactgaaccgtccatcaaggaggatcaggtcatccagctcatgaacacaatc
ttcagcaagaagaactttgagtccctctcagaagccttcagtgtggcctctgctgctgct
gcattgtcccagaatcgctatcacgtaccagtggtggttgttcctgagggctctgcttct
gacactcaagaacaggctatcctgcggttgcaagtcagcagtgttttgtctcacgctctg
gctcaagccgcagttaagctggaacatgctaagtccgtggcttccagagctactgtcctg
cagaagatgcccttttcacttgtaggggatgtttttgagctaaacttcaagaatgttaaa
cttcccagtggctactatgacttctctgtcagagttgaaggtgacaaccgttacattgca
aacactgtagagcttagagtcaagatctccactgaagttggcatcaccaatgctgatctt
tccactgtggacaaggatcagagcatcccacccaaaactacccgggtgacctacccagcc
aaagccaagggcacattcatcgcagacagccatcagaacttcgccctgtttttccagctg
gtagatgtgaacaccggtgcggagctcacccctcaccagacatttgttcgacttcataac
cagaagactggccaggaagtggtgtttgttgctgagccggataacaagaatgtgcataag
tttgaactggacacctctgaaaggaagattgagttcgactctgcctctggcacttacaca
ctctacctaatcatcggggacgccactttgaagaaccccatcctctggaacgtggctgat
gtggttatcaagttccctgaagaagaagctccctccactgtgctgtcccagaaccttttt
accccaaaacaggaaattcagcacctgttccgagagcctgagaagaggccccccactgtg
gtgtccaatacattcacggccctcatcctctcgcccttgctcctgctctttgcactgtgg
atccggattggagccaatgtctccaacttcacctttgctcctaccacgattatctttcac
ctgggacatgctgcaatgctggggctcatgtatgtctactggactcagctcaacatgttc
cagaccctgaagtacctggccgtcctgggcactgtgacatttctggctggcaaccgaatg
ctggcccagcaggcagttaagagaacagcacattag

DBGET integrated database retrieval system