KEGG   Rattus norvegicus (rat): 64709Help
Entry
64709             CDS       T01003                                 

Gene name
Nucks1, Nucks
Definition
(RefSeq) nuclear casein kinase and cyclin-dependent kinase substrate 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 64709
NCBI-ProteinID: NP_073636
RGD: 620993
Ensembl: ENSRNOG00000047287
UniProt: Q9EPJ0
Position
13q13
AA seq 243 aa AA seqDB search
MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPAKKIRSSPREAKNKRRSGKNSQEDSED
SEEKDVKTKKDDSHSAEDSEDEKDDHKSVRQQRQAASKAASKQREMLLEDVGSEEEPEED
DEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTP
SPVKGKGKVGRPTASKTSKEKTPSPKEEDEEAESPPEKKTSASPPLEKSGDEGSEDEAAS
GED
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggcctgtcagaaataggaaggtcgttgattactcacagtttcaggagtcagat
gatgcagacgaagattatggaagagattcaggccctcctgctaagaagattcggtcatct
ccccgagaggctaaaaataagaggcgatctggcaaaaattcacaagaagacagtgaagac
tcagaagaaaaagatgtgaagaccaagaaggatgattctcactcagcagaagacagtgag
gatgaaaaagatgaccataaaagtgtacgccagcagcggcaggcagcatcaaaagcagct
tctaagcagagagagatgctcttggaagatgtgggcagcgaggaggagccggaagaagat
gatgaggcgccattccaggagaaagattctggcagcgacgaagatttcctaatggaggac
gacgatgatagtgattatggcagttcaaaaaagaaaaacaaaaagatggttaagaagtcc
aaacctgagaggaaagaaaagaaaatgcccaaacccagactaaaggctacagtgacacca
agtccagtgaaaggcaaggggaaagtgggtcgccccacggcttcaaagacatcaaaggaa
aaaactccttctcccaaagaagaggacgaggaagcagaaagccctccagaaaagaagaca
tctgcaagccccccactcgagaagtctggagatgaagggtctgaagatgaagcggcatct
ggggaagattaa

DBGET integrated database retrieval system