KEGG   Rattus norvegicus (rat): 64803
Entry
64803             CDS       T01003                                 

Gene name
P2ry12, P2y12
Definition
(RefSeq) purinergic receptor P2Y12
  KO
K04298  P2Y purinoceptor 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    64803 (P2ry12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    64803 (P2ry12)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    64803 (P2ry12)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 64803
NCBI-ProteinID: NP_073637
RGD: 621681
Ensembl: ENSRNOG00000013902
Vega: OTTRNOG00000001299
UniProt: Q9EPX4
Position
2q26
AA seq 343 aa
MEVPGANATSANTTSIPGTSTLCSRDYKITQVLFPLLYTVLFFAGLITNSLAMRIFFQIR
SKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGHLRTLVCQVTSVTFYFTMYISISF
LGLITIDRYLKTTRPFKTSSPSNLLGAKILSVAIWAFMFLLSLPNMILTNRRPKDKDITK
CSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGSAKAPKKRV
NIKVFIIIAVFFICFVPFHFARIPYTLSQTRAVFDCNAENTLFYVKESTLWLTSLNACLD
PFIYFFLCKSFRNSLMSMLRCSTSGANKKKGQEGGDPSEETPM
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggaggtgcctggtgccaacgccacctcagccaacaccacctccattcctgggaccagc
accctgtgcagcagagactacaagatcacccaggttctcttcccattgctctacactgtc
ctgttttttgctgggctcatcacgaacagcttggcgatgaggattttcttccagatccgc
agtaaatcgaacttcatcatttttcttaagaacacggtcatctctgatcttcttatgatc
ctaacttttcctttcaaaattctcagtgatgccaaactgggagctgggcacctgagaacc
ctggtgtgccaagtcacttcagtcacgttttacttcacaatgtacatcagtatctcgttc
ctcggattgataaccattgaccgatacctgaagaccaccagaccatttaaaacttccagc
cccagcaatcttttgggtgcgaagattctttctgttgccatctgggccttcatgttcctg
ctgtcactgcctaacatgattctcaccaacaggaggccaaaagataaggacataacgaaa
tgttctttcttgaagtcggagtttggtctggtctggcacgagatagtcaattacatctgc
caagtcattttctggattaattttttaattgttattgtttgttacagcctcattacaaaa
gagctctataggtcctacgtcagaacgaggggttcagccaaagctcccaagaaaagggtg
aacatcaaggttttcatcatcattgctgtgttcttcatttgcttcgttcccttccacttt
gcacggattccctacaccctgagccagacacgggccgtctttgactgcaatgccgagaac
actctgttctacgtgaaggagagcaccctgtggctgacgtccttgaacgcctgccttgat
ccattcatctatttctttctttgcaagtctttcagaaattccttgatgagcatgctgagg
tgctcaacatccggggcaaataagaagaaaggacaggaaggtggggacccaagcgaggag
accccaatgtag

DBGET integrated database retrieval system